PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KN541991.1_FGP001

Organism

Oryza longistaminata

Taxonomic ID

4528

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

MYB_related

Protein Properties

Length: 53aa MW: 6006.79 Da PI: 6.4979

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KN541991.1_FGP001	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	38.8	2.1e-12	14	45	1	32
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g+WT+eEd+ lv +v+++G+g+W++++ + g KN541991.1_FGP001 14 KGPWTPEEDLVLVSYVQEHGPGNWRAVPTRTG 45 79************************998876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	2.8E-14	5	43	IPR009057	Homeodomain-like
SuperFamily	SSF46689	2.66E-10	9	44	IPR009057	Homeodomain-like
PROSITE profile	PS51294	14.844	9	53	IPR017930	Myb domain
Pfam	PF00249	1.0E-10	14	45	IPR001005	SANT/Myb domain
CDD	cd00167	4.73E-8	16	47	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 53 aa Download sequence Send to blast
MVRPPCCDKD GVKKGPWTPE EDLVLVSYVQ EHGPGNWRAV PTRTGDDHLY RLS

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to the DNA sequence 5'-AACAAAC-3' (PubMed:19170933). Acts as a positive regulator of hypersensitive cell death (PubMed:10571865, PubMed:12119395). Acts as a positive regulator of salicylic acid synthesis (PubMed:16730712). Regulates very-long-chain fatty acid biosynthesis (PubMed:18326828). Acts cooperatively with BZR2 to promote expression of a subset of brassinosteroids target genes (PubMed:19170933). Transcriptional activity and hypersensitive response control negatively regulated by PLA2-ALPHA and by the Xanthomonas type III effector XopD (AC G9L9K6) (PubMed:20696912, PubMed:21917550). Involved in the regulation of abscisic acid (ABA) signaling (PubMed:22814374). Increased levels of MYB30 can accelerate flowering both in long and short days through the regulation of FT (PubMed:24587042). {ECO:0000269\|PubMed:10571865, ECO:0000269\|PubMed:12119395, ECO:0000269\|PubMed:16730712, ECO:0000269\|PubMed:18326828, ECO:0000269\|PubMed:19170933, ECO:0000269\|PubMed:20696912, ECO:0000269\|PubMed:21917550, ECO:0000269\|PubMed:22814374, ECO:0000269\|PubMed:24587042}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KN541991.1_FGP001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated during hypersensitive response, but no expression detected during compatible interaction with pathogens (PubMed:10571865). Specifically induced in the inoculated zone 4 hours post pathogen infection (PubMed:20696912). Up-regulated by jasmonic acid and salicylic acid (PubMed:16463103, PubMed:16730712). Transcriptionally regulated by BZR2 (PubMed:19170933). {ECO:0000269\|PubMed:10571865, ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:16730712, ECO:0000269\|PubMed:19170933, ECO:0000269\|PubMed:20696912}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP004260	3e-85	AP004260.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0011H09.
GenBank	AP004306	3e-85	AP004306.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0506F02.
GenBank	AP014963	3e-85	AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBank	CP012615	3e-85	CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004489392.1	1e-25	myb-related protein 306-like
Refseq	XP_015645343.1	2e-25	transcription factor MYB30
Swissprot	Q9SCU7	3e-25	MYB30_ARATH; Transcription factor MYB30
TrEMBL	B8B4W9	2e-25	B8B4W9_ORYSI; Uncharacterized protein
TrEMBL	Q7X8X3	2e-25	Q7X8X3_ORYSJ; Os07g0629000 protein
STRING	OS07T0629000-01	3e-26	(Oryza sativa)
STRING	LPERR07G20060.1	2e-25	(Leersia perrieri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP229	38	296

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28910.1	1e-27	myb domain protein 30

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kaurilind E,Xu E,Brosché M A genetic framework for H2O2 induced cell death in Arabidopsis thaliana. BMC Genomics, 2015. 16: p. 837 [PMID:26493993] Lee HG,Seo PJ The Arabidopsis MIEL1 E3 ligase negatively regulates ABA signalling by promoting protein turnover of MYB96. Nat Commun, 2016. 7: p. 12525 [PMID:27615387] Serrano I, et al. A non canonical subtilase attenuates the transcriptional activation of defence responses in Arabidopsis thaliana. Elife, 2017. [PMID:27685353] Liao C,Zheng Y,Guo Y MYB30 transcription factor regulates oxidative and heat stress responses through ANNEXIN-mediated cytosolic calcium signaling in Arabidopsis. New Phytol., 2017. 216(1): p. 163-177 [PMID:28726305] Lee HG,Kim J,Suh MC,Seo PJ The MIEL1 E3 Ubiquitin Ligase Negatively Regulates Cuticular Wax Biosynthesis in Arabidopsis Stems. Plant Cell Physiol., 2017. 58(7): p. 1249-1259 [PMID:28838126] Mabuchi K, et al. MYB30 links ROS signaling, root cell elongation, and plant immune responses. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(20): p. E4710-E4719 [PMID:29712840] Zheng Y,Chen Z,Ma L,Liao C The Ubiquitin E3 Ligase RHA2b Promotes Degradation of MYB30 in Abscisic Acid Signaling. Plant Physiol., 2018. 178(1): p. 428-440 [PMID:30030326]