![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KN542159.1_FGP001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 78aa MW: 8885.85 Da PI: 6.2438 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 34.6 | 4.6e-11 | 33 | 71 | 4 | 44 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
+T+eE++l + +++ G++ W++Ia +++ gRt+k++ +w
KN542159.1_FGP001 33 FTEEEEDLVFRMHRLVGNR-WELIAGRIP-GRTAKEVEMFW 71
8******************.*********.******98887 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 1.9E-7 | 29 | 77 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.9E-13 | 33 | 71 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 4.25E-9 | 33 | 71 | No hit | No description |
| PROSITE profile | PS50090 | 7.073 | 33 | 71 | IPR017877 | Myb-like domain |
| SuperFamily | SSF46689 | 2.11E-9 | 33 | 72 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 3.6E-10 | 33 | 71 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:1900033 | Biological Process | negative regulation of trichome patterning | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 78 aa Download sequence Send to blast |
MDSSSGSQGK NSKTSDGCET KEVNSTAQNF IHFTEEEEDL VFRMHRLVGN RWELIAGRIP 60 GRTAKEVEMF WAVKHQNT |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation. May function by suppressing the expression of GL3. {ECO:0000269|PubMed:22168948}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KN542159.1_FGP001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CT833447 | 1e-120 | CT833447.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA029N02, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006644378.1 | 5e-45 | PREDICTED: MYB-like transcription factor ETC3 | ||||
| Swissprot | B3H4X8 | 7e-21 | TCL2_ARATH; MYB-like transcription factor TCL2 | ||||
| TrEMBL | A0A0D3ERB6 | 1e-50 | A0A0D3ERB6_9ORYZ; Uncharacterized protein | ||||
| TrEMBL | A2WSP8 | 1e-50 | A2WSP8_ORYSI; Uncharacterized protein | ||||
| TrEMBL | A2ZVH2 | 1e-50 | A2ZVH2_ORYSJ; Uncharacterized protein | ||||
| STRING | OBART01G22980.1 | 2e-51 | (Oryza barthii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP5275 | 31 | 57 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G30424.1 | 3e-23 | MYB_related family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




