![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KXZ41330.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 102aa MW: 11088.3 Da PI: 6.7505 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 78.4 | 1.1e-24 | 35 | 94 | 1 | 60 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS-- CS
SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekr 60
+Cq++gC adls +k+y+rr++vCe+h +a+vvl+sg+ rfC qCs fh+ls fD ++r
KXZ41330.1 35 RCQADGCLADLSGLKRYFRRYHVCETHIRAQVVLISGRPVRFCDQCSTFHALSFFDGTRR 94
6*******************************************************9998 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 4.7E-26 | 30 | 94 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 19.025 | 33 | 102 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 3.4E-22 | 35 | 94 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 1.5E-23 | 36 | 94 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 102 aa Download sequence Send to blast |
MSYQAEGSGG DGLDLAGGTA DGERVNQGAE VTANRCQADG CLADLSGLKR YFRRYHVCET 60 HIRAQVVLIS GRPVRFCDQC STFHALSFFD GTRRWEAGRG GE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 4e-14 | 36 | 94 | 11 | 69 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}. | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002952986.1 | 1e-31 | hypothetical protein VOLCADRAFT_93794 | ||||
| Swissprot | A2YFT9 | 2e-17 | SPL10_ORYSI; Squamosa promoter-binding-like protein 10 | ||||
| Swissprot | Q0DAE8 | 2e-17 | SPL10_ORYSJ; Squamosa promoter-binding-like protein 10 | ||||
| TrEMBL | A0A150FWC1 | 1e-68 | A0A150FWC1_GONPE; Uncharacterized protein | ||||
| STRING | XP_002952986.1 | 4e-31 | (Volvox carteri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Chlorophytae | OGCP20 | 12 | 101 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G27370.4 | 5e-18 | squamosa promoter binding protein-like 10 | ||||




