![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KZV13853.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 68aa MW: 7967.96 Da PI: 10.2359 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 57.2 | 5.8e-18 | 1 | 45 | 83 | 128 |
NAM 83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
Wkat d+++ + ++e +glkktLvfy+g+ap+g+kt+W+mhey+l
KZV13853.1 1 WKATVADQRIQE-RQEIIGLKKTLVFYHGKAPNGKKTNWIMHEYTL 45
***********9.999****************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF02365 | 5.1E-8 | 1 | 45 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 20.371 | 1 | 66 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 1.7E-16 | 1 | 52 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 68 aa Download sequence Send to blast |
WKATVADQRI QERQEIIGLK KTLVFYHGKA PNGKKTNWIM HEYTLRQRST CNDANNNMQV 60 NNYSNSVN |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', and to the tracheary elements (TE) specific regulating cis-element (TERE), 5'-CTTNAAAGCNA-3', in the promoter of target genes (e.g. genes involved in secondary wall biosynthesis, cell wall modification such as xylan accumulation, and programmed cell death) (PubMed:20935069, PubMed:20952636, PubMed:20488898). Involved in xylem formation in roots and shoots, especially regulating metaxylem vessel differentiation by promoting immature xylem vessel-specific genes expression, especially genes regulating programmed cell death (PCD) and secondary wall formation in tracheary elements (TE) (PubMed:16103214, PubMed:20952636, PubMed:20488898). Can activate MYB25, MYB46, MYB58, MYB63, MYB83, MYB103, CESA4, LBD15, LBD30, ERF115, XCP1, XCP2, NAC010/SND3, KNAT7, ASL19 and ASL20 expression (PubMed:17890373, PubMed:18952777, PubMed:19088331, PubMed:19122102, PubMed:19808805, PubMed:20935069, PubMed:20952636). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:19088331, ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:20488898, ECO:0000269|PubMed:20935069, ECO:0000269|PubMed:20952636}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KZV13853.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By brassinosteroids (e.g. brassinolide BL), auxin (e.g. 2,4-dichlorphenoxyacetic acid 2,4-D) and cytokinin (e.g. kinetin), with a synergistic effect (PubMed:16103214). Accumulates during infection by the soilborne fungal pathogen Verticillium longisporum, especially in tissues undergoing de novo xylem formation (PubMed:23023171). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:23023171}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002976911.1 | 4e-15 | NAC domain-containing protein 105 | ||||
| Refseq | XP_002980632.2 | 4e-15 | NAC domain-containing protein 105 | ||||
| Refseq | XP_018842746.1 | 4e-15 | PREDICTED: NAC domain-containing protein 62-like | ||||
| Swissprot | Q9LVA1 | 4e-15 | NC101_ARATH; NAC domain-containing protein 101 | ||||
| TrEMBL | A0A2Z6ZYF5 | 8e-44 | A0A2Z6ZYF5_9LAMI; NAC domain-containing protein 100-like (Fragment) | ||||
| STRING | EFJ18283 | 6e-15 | (Selaginella moellendorffii) | ||||
| STRING | EFJ22021 | 1e-14 | (Selaginella moellendorffii) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G62380.1 | 7e-17 | NAC-domain protein 101 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




