![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KZV21889.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 59aa MW: 7018.08 Da PI: 9.1139 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 26.4 | 1.6e-08 | 3 | 40 | 6 | 45 |
HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
++E++++ + +k+ G + W++Ia +++ gR ++++ +w+
KZV21889.1 3 EQEEDIISRMHKLVGDK-WALIAGRVP-GRKPEEIERYWL 40
89*************99.*********.***********7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 10.231 | 1 | 47 | IPR017930 | Myb domain |
| CDD | cd00167 | 4.33E-5 | 1 | 41 | No hit | No description |
| SMART | SM00717 | 0.0027 | 1 | 45 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 8.9E-11 | 3 | 40 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 8.3E-8 | 3 | 41 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 2.18E-7 | 3 | 46 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010091 | Biological Process | trichome branching | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 59 aa Download sequence Send to blast |
MNEQEEDIIS RMHKLVGDKW ALIAGRVPGR KPEEIERYWL MKNKDGFIES SKERAQKMN |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KZV21889.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009119863.1 | 2e-23 | PREDICTED: transcription factor TRY | ||||
| Refseq | XP_013609347.1 | 3e-23 | PREDICTED: transcription factor TRY-like | ||||
| Refseq | XP_013714345.1 | 2e-23 | transcription factor TRY | ||||
| Refseq | XP_013726794.1 | 2e-23 | transcription factor TRY | ||||
| Refseq | XP_022565509.1 | 2e-23 | transcription factor TRY | ||||
| Refseq | XP_027102535.1 | 2e-23 | transcription factor TRY-like | ||||
| Swissprot | Q8GV05 | 4e-22 | TRY_ARATH; Transcription factor TRY | ||||
| TrEMBL | A0A2Z7ARA3 | 3e-35 | A0A2Z7ARA3_9LAMI; Transcription factor TRY | ||||
| STRING | VIT_16s0050g02530.t01 | 2e-22 | (Vitis vinifera) | ||||
| STRING | Bo9g110930.1 | 3e-22 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA11707 | 18 | 24 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G53200.1 | 2e-24 | MYB_related family protein | ||||




