 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KZV25881.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 61aa MW: 7009.23 Da PI: 11.081 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 100.1 | 8.3e-32 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien rqvtfskRrngilKKA+ELSvLCdaeva+iifs++g+lye+ss
KZV25881.1 9 KRIENAASRQVTFSKRRNGILKKAYELSVLCDAEVALIIFSQKGRLYEFSS 59
79***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.5E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 32.113 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 3.92E-29 | 3 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 9.25E-36 | 3 | 60 | No hit | No description |
| PRINTS | PR00404 | 3.0E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.3E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 61 aa Download sequence Send to blast |
MVRGKVQMKR IENAASRQVT FSKRRNGILK KAYELSVLCD AEVALIIFSQ KGRLYEFSSS 60 R |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 2e-19 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 2e-19 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 2e-19 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 2e-19 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 2e-19 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 2e-19 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 2e-19 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 2e-19 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 2e-19 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 2e-19 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KZV25881.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018625082.1 | 1e-35 | PREDICTED: MADS-box protein AGL42-like | ||||
| Refseq | XP_018625083.1 | 1e-35 | PREDICTED: MADS-box protein AGL42-like | ||||
| Refseq | XP_018625084.1 | 1e-35 | PREDICTED: MADS-box protein AGL42-like | ||||
| Refseq | XP_018625085.1 | 1e-35 | PREDICTED: MADS-box protein AGL42-like | ||||
| Swissprot | Q9FIS1 | 4e-32 | AGL42_ARATH; MADS-box protein AGL42 | ||||
| TrEMBL | A0A2Z7AVE5 | 1e-35 | A0A2Z7AVE5_9LAMI; Uncharacterized protein | ||||
| STRING | XP_009779702.1 | 1e-34 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA40 | 24 | 625 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G62165.4 | 1e-34 | AGAMOUS-like 42 | ||||
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|