![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KZV33711.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 95aa MW: 10478.2 Da PI: 10.6083 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 63.4 | 4.1e-20 | 37 | 77 | 15 | 55 |
G2-like 15 veaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
veav+qLG ++AtPk l++m+ +gLt++hvkSHLQkYRl
KZV33711.1 37 VEAVAQLGILDRATPKGALHIMGFQGLTIYHVKSHLQKYRL 77
9***************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 5.6E-19 | 36 | 78 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 8.5E-15 | 37 | 78 | IPR006447 | Myb domain, plants |
| SuperFamily | SSF46689 | 5.55E-8 | 37 | 78 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MAGWGKTIGF GSAKKVQSRS SKAGLHHLYF WRFGCSVEAV AQLGILDRAT PKGALHIMGF 60 QGLTIYHVKS HLQKYRLAKY LPDSSSDGTN LDKKI |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4k_A | 4e-15 | 37 | 80 | 16 | 59 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4k_B | 4e-15 | 37 | 80 | 16 | 59 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_A | 4e-15 | 37 | 80 | 16 | 59 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_C | 4e-15 | 37 | 80 | 16 | 59 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_D | 4e-15 | 37 | 80 | 16 | 59 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_F | 4e-15 | 37 | 80 | 16 | 59 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_H | 4e-15 | 37 | 80 | 16 | 59 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_J | 4e-15 | 37 | 80 | 16 | 59 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KZV33711.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009776486.1 | 5e-26 | PREDICTED: myb family transcription factor APL-like | ||||
| Refseq | XP_009776487.1 | 5e-26 | PREDICTED: myb family transcription factor APL-like | ||||
| Refseq | XP_009776488.1 | 5e-26 | PREDICTED: myb family transcription factor APL-like | ||||
| Refseq | XP_009776490.1 | 5e-26 | PREDICTED: myb family transcription factor APL-like | ||||
| Refseq | XP_012841911.1 | 5e-26 | PREDICTED: protein PHR1-LIKE 1-like | ||||
| Refseq | XP_012841912.1 | 5e-26 | PREDICTED: protein PHR1-LIKE 1-like | ||||
| Refseq | XP_012841913.1 | 5e-26 | PREDICTED: protein PHR1-LIKE 1-like | ||||
| Refseq | XP_012841914.1 | 5e-26 | PREDICTED: protein PHR1-LIKE 1-like | ||||
| Refseq | XP_012841915.1 | 5e-26 | PREDICTED: protein PHR1-LIKE 1-like | ||||
| Refseq | XP_012841917.1 | 5e-26 | PREDICTED: protein PHR1-LIKE 1-like | ||||
| Refseq | XP_012841918.1 | 5e-26 | PREDICTED: protein PHR1-LIKE 1-like | ||||
| Refseq | XP_016456548.1 | 4e-26 | PREDICTED: myb family transcription factor APL-like | ||||
| Refseq | XP_016456549.1 | 4e-26 | PREDICTED: myb family transcription factor APL-like | ||||
| Swissprot | Q9SJW0 | 9e-25 | PHL7_ARATH; Myb family transcription factor PHL7 | ||||
| TrEMBL | A0A2Z7BP36 | 1e-63 | A0A2Z7BP36_9LAMI; Myb family transcription factor family protein | ||||
| STRING | XP_009776486.1 | 2e-25 | (Nicotiana sylvestris) | ||||
| STRING | Migut.H01641.1.p | 2e-25 | (Erythranthe guttata) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G01060.1 | 4e-27 | G2-like family protein | ||||




