![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KZV37364.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 167aa MW: 17844.9 Da PI: 8.2222 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 176.2 | 3.1e-55 | 28 | 121 | 1 | 94 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
vreqdrflPian++rimkk+lPan+ki+kdak+tvqecvsefisf+tseasdkcq+ekrktingddllwa+atlGfe+y+ plk+yl++yre +
KZV37364.1 28 VREQDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLLWAMATLGFEEYISPLKAYLARYREGD 121
69*****************************************************************************************965 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.6E-53 | 24 | 135 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 3.18E-39 | 31 | 145 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 7.7E-29 | 34 | 98 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 3.6E-20 | 62 | 80 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 65 | 81 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 3.6E-20 | 81 | 99 | No hit | No description |
| PRINTS | PR00615 | 3.6E-20 | 100 | 118 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 167 aa Download sequence Send to blast |
MAESPGGHAG GSGSHDSGGG DHSPQSSVRE QDRFLPIANI GRIMKKALPA NGKIAKDAKD 60 TVQECVSEFI SFITSEASDK CQKEKRKTIN GDDLLWAMAT LGFEEYISPL KAYLARYREG 120 DAKGSARAGD GSSKKDTIGT QLPSASQFVH QAPFPQGFSY SGSQIKF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 9e-47 | 27 | 119 | 1 | 93 | NF-YB |
| 4awl_B | 8e-47 | 27 | 119 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 8e-47 | 27 | 119 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KZV37364.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011077038.1 | 3e-89 | nuclear transcription factor Y subunit B-1 | ||||
| Refseq | XP_020548913.1 | 3e-89 | nuclear transcription factor Y subunit B-1 | ||||
| Swissprot | Q8VYK4 | 2e-74 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A2Z7BSJ9 | 1e-119 | A0A2Z7BSJ9_9LAMI; Nuclear transcription factor Y subunit B-1-like | ||||
| STRING | Migut.F02024.1.p | 7e-83 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA111 | 24 | 356 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37060.3 | 2e-69 | nuclear factor Y, subunit B8 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




