![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KZV39664.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 61aa MW: 7243.91 Da PI: 5.7674 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 43.3 | 1.1e-13 | 12 | 58 | 54 | 101 |
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvg 101
+e++wyfF++r++ky++++r+ r++ +gyWkat dk +++ ++ vg
KZV39664.1 12 GENDWYFFTSRERKYTNESRPDRQAGNGYWKATVGDKMIYD-NHVIVG 58
678*************************************9.665555 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 17.904 | 1 | 61 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 6.15E-15 | 10 | 59 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 61 aa Download sequence Send to blast |
WIFTTASYKS LGENDWYFFT SRERKYTNES RPDRQAGNGY WKATVGDKMI YDNHVIVGQE 60 D |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KZV39664.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006453417.1 | 2e-15 | NAC transcription factor 25 | ||||
| TrEMBL | A0A2Z7BZ32 | 2e-38 | A0A2Z7BZ32_9LAMI; Uncharacterized protein (Fragment) | ||||
| STRING | XP_006474630.1 | 4e-15 | (Citrus sinensis) | ||||
| STRING | XP_006453410.1 | 4e-15 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA746 | 24 | 103 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G77450.1 | 1e-14 | NAC domain containing protein 32 | ||||




