![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | KZV39710.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 74aa MW: 8282.71 Da PI: 10.1108 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 61.3 | 2e-19 | 13 | 56 | 12 | 55 |
G2-like 12 erFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
+ F + v+qLG +++AtPk l++++v+gLt++hvkSHLQkYRl
KZV39710.1 13 KLFKHIVAQLGIPDRATPKGALHIVGVQGLTIYHVKSHLQKYRL 56
668999*************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 3.2E-18 | 10 | 57 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.31E-8 | 11 | 56 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 3.1E-14 | 13 | 56 | IPR006447 | Myb domain, plants |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 74 aa Download sequence Send to blast |
MEGVLFCKPH FEKLFKHIVA QLGIPDRATP KGALHIVGVQ GLTIYHVKSH LQKYRLANYL 60 PDSSSDGTKP DKKI |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | KZV39710.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009615786.1 | 5e-26 | PREDICTED: myb family transcription factor PHL7-like | ||||
| Refseq | XP_009787053.1 | 7e-26 | PREDICTED: myb family transcription factor APL-like | ||||
| Refseq | XP_012450884.1 | 6e-26 | PREDICTED: myb family transcription factor APL | ||||
| Refseq | XP_012450885.1 | 6e-26 | PREDICTED: myb family transcription factor APL | ||||
| Refseq | XP_017642563.1 | 6e-26 | PREDICTED: myb family transcription factor PHL7 | ||||
| Swissprot | Q9SJW0 | 2e-25 | PHL7_ARATH; Myb family transcription factor PHL7 | ||||
| TrEMBL | A0A2Z7C5L4 | 2e-47 | A0A2Z7C5L4_9LAMI; Uncharacterized protein | ||||
| STRING | XP_009787053.1 | 3e-25 | (Nicotiana sylvestris) | ||||
| STRING | XP_009615786.1 | 2e-25 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA10101 | 20 | 26 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G01060.1 | 1e-27 | G2-like family protein | ||||




