PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KZV44852.1

Organism

Dorcoceras hygrometricum

Taxonomic ID

472368

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras

Family

CAMTA

Protein Properties

Length: 121aa MW: 14393.7 Da PI: 9.9202

Description

CAMTA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KZV44852.1	genome	CNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CG-1	152.7	8.2e-48	11	116	2	108
CG-1 2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcyw 100 ++ k+rwl+++ei+aiL nf+ +++ ++ + pksg+++L++rk++r+frkDGy+wkkkkdgktv+E+he+LKvg+ e +++yYah+e+ ptf rrcyw KZV44852.1 11 VEAKARWLRPNEIHAILCNFKYFTVNVKPVNLPKSGTIVLFDRKMFRNFRKDGYKWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYW 109 6779********************************************************************************************* PP CG-1 101 lLeeelek 108 lL++ e+ KZV44852.1 110 LLDKY-EN 116 987.44 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51437	63.402	6	121	IPR005559	CG-1 DNA-binding domain
SMART	SM01076	1.1E-60	9	118	IPR005559	CG-1 DNA-binding domain
Pfam	PF03859	1.3E-41	12	115	IPR005559	CG-1 DNA-binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 121 aa Download sequence Send to blast
LIDLDVGAIM VEAKARWLRP NEIHAILCNF KYFTVNVKPV NLPKSGTIVL FDRKMFRNFR 60 KDGYKWKKKK DGKTVKEAHE HLKVGNEERI HVYYAHGEDS PTFVRRCYWL LDKYENTNTF 120 C

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator (PubMed:14581622). Binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in response to cold. Contributes together with CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:28351986). {ECO:0000250\|UniProtKB:Q8GSA7, ECO:0000269\|PubMed:14581622, ECO:0000269\|PubMed:28351986, ECO:0000305\|PubMed:11925432}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KZV44852.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat shock, UVB, wounding, abscisic acid, H(2)O(2) and salicylic acid. {ECO:0000269\|PubMed:12218065}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003547365.1	9e-66	calmodulin-binding transcription activator 5
Refseq	XP_008223308.1	7e-66	PREDICTED: calmodulin-binding transcription activator 5-like isoform X1
Refseq	XP_022874687.1	9e-67	calmodulin-binding transcription activator 5-like isoform X1
Refseq	XP_022874688.1	9e-67	calmodulin-binding transcription activator 5-like isoform X1
Refseq	XP_022874689.1	9e-67	calmodulin-binding transcription activator 5-like isoform X2
Refseq	XP_028204125.1	9e-66	calmodulin-binding transcription activator 5-like
Swissprot	O23463	1e-58	CMTA5_ARATH; Calmodulin-binding transcription activator 5
TrEMBL	A0A2Z7CCV0	2e-85	A0A2Z7CCV0_9LAMI; Calmodulin-binding transcription activator 5-like (Fragment)
STRING	Lus10041126	7e-67	(Linum usitatissimum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA14489	8	11

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G16150.1	1e-55	calmodulin binding;transcription regulators

Publications ? help Back to Top
Ye J, et al. Arabidopsis formin3 directs the formation of actin cables and polarized growth in pollen tubes. Plant Cell, 2009. 21(12): p. 3868-84 [PMID:20023198] Kidokoro S, et al. Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature. Plant Cell, 2017. 29(4): p. 760-774 [PMID:28351986] Lan Y,Liu X,Fu Y,Huang S Arabidopsis class I formins control membrane-originated actin polymerization at pollen tube tips. PLoS Genet., 2018. 14(11): p. e1007789 [PMID:30418966]