PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KZV45489.1

Organism

Dorcoceras hygrometricum

Taxonomic ID

472368

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras

Family

MYB

Protein Properties

Length: 225aa MW: 26114.4 Da PI: 10.5108

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KZV45489.1	genome	CNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	50.6	4.4e-16	32	77	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W Ed +l ++v+ +G+ +W++Ia+++ gR++k+c++rw++ KZV45489.1 32 RGHWKSSEDTKLRELVATYGPQNWNLIAEELK-GRSGKSCRLRWHNQ 77 899**************************9.**********96 PP
2	Myb_DNA-binding	53.6	5.3e-17	84	128	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g++++eE+ +l a +q+G++ W++I+r ++ gRt++ +k++w+ + KZV45489.1 84 KGAFSEEEEGRLMAAQTQYGNK-WALISRLFP-GRTDNAVKNHWHVL 128 799*****************.*****.*********987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.776	27	78	IPR017930	Myb domain
SMART	SM00717	6.9E-14	31	80	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	4.69E-28	32	129	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	4.1E-26	33	85	IPR009057	Homeodomain-like
CDD	cd00167	2.67E-11	35	76	No hit	No description
Pfam	PF13921	5.1E-17	35	95	No hit	No description
PROSITE profile	PS51294	24.467	79	133	IPR017930	Myb domain
SMART	SM00717	7.9E-12	83	131	IPR001005	SANT/Myb domain
CDD	cd00167	1.91E-7	86	129	No hit	No description
Gene3D	G3DSA:1.10.10.60	4.9E-20	86	132	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 225 aa Download sequence Send to blast
MGACGEKSKR NGKNSDRNRE KFKFKQSKLC SRGHWKSSED TKLRELVATY GPQNWNLIAE 60 ELKGRSGKSC RLRWHNQLDP KINKGAFSEE EEGRLMAAQT QYGNKWALIS RLFPGRTDNA 120 VKNHWHVLMA RRYKELSKSY MELGKWNSQP TNSYNRSRFN TDNQNSLTSG WERRRWLMKR 180 EKLFKDPIIN YDLSFAEGSS GGESYVDQNS SKKPTFIDFL GVGVS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1mse_C	1e-32	29	132	1	104	C-Myb DNA-Binding Domain
1msf_C	1e-32	29	132	1	104	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269\|PubMed:20305120}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KZV45489.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by wounding. {ECO:0000269\|PubMed:20305120}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011098643.2	3e-65	myb-related protein A-like isoform X2
Swissprot	Q5NBM8	3e-61	CSA_ORYSJ; Transcription factor CSA
TrEMBL	A0A2Z7CLB3	1e-166	A0A2Z7CLB3_9LAMI; Myb-like protein AA
STRING	XP_004172495.1	1e-65	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1684	24	70

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69560.1	6e-63	myb domain protein 105

Publications ? help Back to Top
Leonard LM,Follette VM Sexual functioning in women reporting a history of child sexual abuse: review of the empirical literature and clinical implications. Annu Rev Sex Res, 2002. 13: p. 346-88 [PMID:12836736] Wang L,Li X,Chen Z Sulfated modification of the polysaccharides obtained from defatted rice bran and their antitumor activities. Int. J. Biol. Macromol., 2009. 44(2): p. 211-4 [PMID:19135473] Wang L,Huang H,Wei Y,Li X,Chen Z Characterization and anti-tumor activities of sulfated polysaccharide SRBPS2a obtained from defatted rice bran. Int. J. Biol. Macromol., 2009. 45(4): p. 427-31 [PMID:19549538] Zhang H, et al. Carbon starved anther encodes a MYB domain protein that regulates sugar partitioning required for rice pollen development. Plant Cell, 2010. 22(3): p. 672-89 [PMID:20305120] Zhang H, et al. Mutation in CSA creates a new photoperiod-sensitive genic male sterile line applicable for hybrid rice seed production. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(1): p. 76-81 [PMID:23256151] Zhu X, et al. Brassinosteroids promote development of rice pollen grains and seeds by triggering expression of Carbon Starved Anther, a MYB domain protein. Plant J., 2015. 82(4): p. 570-81 [PMID:25754973] Li X, et al. Metabolic and transcriptomic signatures of rice floral organs reveal sugar starvation as a factor in reproductive failure under heat and drought stress. Plant Cell Environ., 2015. 38(10): p. 2171-92 [PMID:25828772] Shaar-Moshe L,Hübner S,Peleg Z Identification of conserved drought-adaptive genes using a cross-species meta-analysis approach. BMC Plant Biol., 2015. 15: p. 111 [PMID:25935420]