PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KZV53233.1

Organism

Dorcoceras hygrometricum

Taxonomic ID

472368

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras

Family

SBP

Protein Properties

Length: 134aa MW: 15420.1 Da PI: 8.8528

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KZV53233.1	genome	CNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	138.7	1.7e-43	54	131	1	78
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 +Cqve+C++d+++ak yhrrhkvCe+h+kapvvl+ gl+qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk+++ KZV53233.1 54 TCQVEDCTVDMANAKPYHRRHKVCEFHAKAPVVLIFGLHQRFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKSSS 131 6**************************************************************************975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF037575	1.4E-56	1	134	IPR017238	Squamosa promoter-binding protein
Gene3D	G3DSA:4.10.1100.10	3.2E-34	47	116	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	32.351	52	129	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	6.08E-39	54	132	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	2.1E-33	55	128	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009911	Biological Process	positive regulation of flower development
GO:0010228	Biological Process	vegetative to reproductive phase transition of meristem
GO:0010229	Biological Process	inflorescence development
GO:0010321	Biological Process	regulation of vegetative phase change
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 134 aa Download sequence Send to blast
MERSRDEEKR LIKVPGYDEE GEEEREAGDD NKKKQASTSS GRKASSSGGS AQRTCQVEDC 60 TVDMANAKPY HRRHKVCEFH AKAPVVLIFG LHQRFCQQCS RFHELSEFDE AKRSCRRRLA 120 GHNERRRKSS SDPH

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	2e-40	46	128	2	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00290	DAP	Transfer from AT2G33810	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KZV53233.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011096328.1	1e-54	squamosa promoter-binding protein 1
Swissprot	Q38741	2e-65	SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBL	A0A2Z7D1J6	2e-93	A0A2Z7D1J6_9LAMI; Squamosa promoter-binding-like protein
STRING	XP_009622640.1	1e-50	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA749	24	105

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G33810.1	2e-45	squamosa promoter binding protein-like 3

Publications ? help Back to Top
Klein J,Saedler H,Huijser P A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA. Mol. Gen. Genet., 1996. 250(1): p. 7-16 [PMID:8569690]