PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KZV55554.1

Organism

Dorcoceras hygrometricum

Taxonomic ID

472368

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras

Family

Protein Properties

Length: 80aa MW: 9251.69 Da PI: 10.2346

Description

B3 family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KZV55554.1	genome	CNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	B3	53.8	3.6e-17	14	75	35	98
EEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS B3 35 tltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 ++ +d +g++W++++iy ++++r++l +GW+ Fv++++L +gD++vF + +++ l+v+++ KZV55554.1 14 NVIAKDVHGETWNFRHIYMGTPRRHLLITGWSTFVNQKKLVAGDSIVFLRA--DNRDLCVGIVG 75 68899********************************************44..56667999875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50863	11.251	1	77	IPR003340	B3 DNA binding domain
SMART	SM01019	0.0011	1	77	IPR003340	B3 DNA binding domain
Gene3D	G3DSA:2.40.330.10	2.8E-21	4	77	IPR015300	DNA-binding pseudobarrel domain
SuperFamily	SSF101936	1.57E-17	9	75	IPR015300	DNA-binding pseudobarrel domain
CDD	cd10017	3.27E-13	13	73	No hit	No description
Pfam	PF02362	4.7E-15	13	74	IPR003340	B3 DNA binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 80 aa Download sequence Send to blast
MHGPNYTADP LMQNVIAKDV HGETWNFRHI YMGTPRRHLL ITGWSTFVNQ KKLVAGDSIV 60 FLRADNRDLC VGIVGRWWTK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4ldv_A	2e-22	5	73	154	222	Auxin response factor 1
4ldw_A	2e-22	5	73	154	222	Auxin response factor 1
4ldw_B	2e-22	5	73	154	222	Auxin response factor 1
4ldx_A	2e-22	5	73	154	222	Auxin response factor 1
4ldx_B	2e-22	5	73	154	222	Auxin response factor 1
4ldy_A	2e-22	5	73	154	222	Auxin response factor 1
4ldy_B	2e-22	5	73	154	222	Auxin response factor 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269\|PubMed:12036261}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KZV55554.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011089287.1	3e-37	auxin response factor 18 isoform X1
Refseq	XP_011089288.1	3e-37	auxin response factor 18 isoform X2
Refseq	XP_011089918.1	2e-37	auxin response factor 18-like
Refseq	XP_020552218.1	2e-37	auxin response factor 18-like
Refseq	XP_020552360.1	3e-37	auxin response factor 18 isoform X1
Swissprot	Q9SKN5	3e-34	ARFJ_ARATH; Auxin response factor 10
TrEMBL	A0A2Z7DDT3	1e-53	A0A2Z7DDT3_9LAMI; Auxin response factor 18-like
STRING	Migut.D02231.1.p	3e-36	(Erythranthe guttata)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G28350.1	1e-36	auxin response factor 10

Publications ? help Back to Top
Yang ZB, et al. TAA1-regulated local auxin biosynthesis in the root-apex transition zone mediates the aluminum-induced inhibition of root growth in Arabidopsis. Plant Cell, 2014. 26(7): p. 2889-904 [PMID:25052716] Bennett T,van den Toorn A,Willemsen V,Scheres B Precise control of plant stem cell activity through parallel regulatory inputs. Development, 2014. 141(21): p. 4055-64 [PMID:25256342] Ye Y, et al. Germostatin resistance locus 1 encodes a PHD finger protein involved in auxin-mediated seed dormancy and germination. Plant J., 2016. 85(1): p. 3-15 [PMID:26611158] Nguyen TC,Obermeier C,Friedt W,Abrams SR,Snowdon RJ Disruption of Germination and Seedling Development in Brassica napus by Mutations Causing Severe Seed Hormonal Imbalance. Front Plant Sci, 2016. 7: p. 322 [PMID:27014334] Liu Z, et al. Repression of callus initiation by the miRNA-directed interaction of auxin-cytokinin in Arabidopsis thaliana. Plant J., 2016. 87(4): p. 391-402 [PMID:27189514] Wójcikowska B,Gaj MD Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis. Plant Cell Rep., 2017. 36(6): p. 843-858 [PMID:28255787] Wójcik AM,Nodine MD,Gaj MD miR160 and miR166/165 Contribute to the LEC2-Mediated Auxin Response Involved in the Somatic Embryogenesis Induction in Arabidopsis. Front Plant Sci, 2017. 8: p. 2024 [PMID:29321785] Lin JS, et al. MicroRNA160 Modulates Plant Development and Heat Shock Protein Gene Expression to Mediate Heat Tolerance in Arabidopsis. Front Plant Sci, 2018. 9: p. 68 [PMID:29449855]