PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KZV56171.1

Organism

Dorcoceras hygrometricum

Taxonomic ID

472368

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras

Family

NAC

Protein Properties

Length: 121aa MW: 13975.7 Da PI: 10.2375

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KZV56171.1	genome	CNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	95.2	1e-29	7	79	55	128
NAM 55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ewyfF++r+ ky++g+r+nra+ +gyWkat d+++ + ++e++g kktLvfy+g++p+g+kt+W+mhey+l KZV56171.1 7 KDEWYFFTSRKLKYPNGSRPNRAAGDGYWKATVADQRIQE-RQEVIGFKKTLVFYHGKTPNGKKTNWIMHEYTL 79 579**********************************9.999**************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	31.011	1	100	IPR003441	NAC domain
SuperFamily	SSF101941	1.96E-29	7	86	IPR003441	NAC domain
Pfam	PF02365	5.5E-15	9	79	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 121 aa Download sequence Send to blast
MYPTLAKDEW YFFTSRKLKY PNGSRPNRAA GDGYWKATVA DQRIQERQEV IGFKKTLVFY 60 HGKTPNGKKT NWIMHEYTLR HRSTGNDANN NMQVNNYSNS VNLTIPNQVS NILFNIGSEV 120 A

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	4e-30	9	79	70	140	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that positively regulates age-dependent senescence, dark-induced leaf senescence and stress-induced senescence. Regulates leaf senescence through the modulation of the expression of senescence-associated genes SGR1/NYE1, SAG113 and SAUR36/SAG201, which are involved in chlorophyll degradation, and abscisic acid (ABA) and auxin promotion of senescence, respectively. Promotes reactive oxygen species (ROS) production during age-dependent and stress-induced senescence. Regulates positively auxin-mediated responses in roots (PubMed:27388337). Stress-responsive NAC transcription factor involved in ABA-inducible leaf senescence signaling (PubMed:26518251). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269\|PubMed:18849494, ECO:0000269\|PubMed:26518251, ECO:0000269\|PubMed:27388337}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KZV56171.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA) (PubMed:26518251). Induced by salinity and osmotic stress, and during leaf senescence (PubMed:27388337). {ECO:0000269\|PubMed:26518251, ECO:0000269\|PubMed:27388337}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004293170.2	2e-30	PREDICTED: uncharacterized protein LOC101294338
Swissprot	Q9CAR0	3e-30	NAC32_ARATH; NAC transcription factor 32
TrEMBL	A0A2Z7D9S8	7e-86	A0A2Z7D9S8_9LAMI; Uncharacterized protein
STRING	XP_004293170.1	8e-30	(Fragaria vesca)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G77450.1	2e-31	NAC domain containing protein 32

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Vermeirssen V,De Clercq I,Van Parys T,Van Breusegem F,Van de Peer Y Arabidopsis ensemble reverse-engineered gene regulatory network discloses interconnected transcription factors in oxidative stress. Plant Cell, 2014. 26(12): p. 4656-79 [PMID:25549671] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Mahmood K,El-Kereamy A,Kim SH,Nambara E,Rothstein SJ ANAC032 Positively Regulates Age-Dependent and Stress-Induced Senescence in Arabidopsis thaliana. Plant Cell Physiol., 2016. 57(10): p. 2029-2046 [PMID:27388337] Allu AD,Brotman Y,Xue GP,Balazadeh S Transcription factor ANAC032 modulates JA/SA signalling in response to Pseudomonas syringae infection. EMBO Rep., 2016. 17(11): p. 1578-1589 [PMID:27632992] Mahmood K,Xu Z,El-Kereamy A,Casaretto JA,Rothstein SJ The Arabidopsis Transcription Factor ANAC032 Represses Anthocyanin Biosynthesis in Response to High Sucrose and Oxidative and Abiotic Stresses. Front Plant Sci, 2016. 7: p. 1548 [PMID:27790239] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239]