![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Kaladp0008s0299.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 136aa MW: 14913.5 Da PI: 4.7461 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 180.8 | 1.2e-56 | 22 | 117 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91
reqdrflPianvsr+mkk lPanakisk+aketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGf++y epl+vyl+kyr
Kaladp0008s0299.1.p 22 REQDRFLPIANVSRLMKKSLPANAKISKEAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMGTLGFDEYDEPLRVYLQKYR 111
89**************************************************************************************** PP
NF-YB 92 elegek 97
e+egek
Kaladp0008s0299.1.p 112 EIEGEK 117
****97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.4E-52 | 19 | 129 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 3.26E-39 | 24 | 123 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 4.0E-27 | 27 | 91 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 4.1E-21 | 55 | 73 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 58 | 74 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 4.1E-21 | 74 | 92 | No hit | No description |
| PRINTS | PR00615 | 4.1E-21 | 93 | 111 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 136 aa Download sequence Send to blast |
MAESDNDSGG NYDGIGHDFL AREQDRFLPI ANVSRLMKKS LPANAKISKE AKETVQECVS 60 EFISFVTGEA SDKCQREKRK TINGDDLLWA MGTLGFDEYD EPLRVYLQKY REIEGEKSAG 120 GKAGERDGNS GGGNR* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 7e-47 | 16 | 112 | 1 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010252766.1 | 9e-70 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
| Swissprot | O23310 | 3e-67 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
| TrEMBL | A0A0H3XSM1 | 2e-68 | A0A0H3XSM1_VERFO; Nuclear transcription factor Y subunit B-11 | ||||
| TrEMBL | A0A1U7ZM17 | 2e-68 | A0A1U7ZM17_NELNU; nuclear transcription factor Y subunit B-3-like | ||||
| STRING | XP_010252766.1 | 3e-69 | (Nelumbo nucifera) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 1e-64 | nuclear factor Y, subunit B3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Kaladp0008s0299.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




