![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Kaladp0016s0028.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 129aa MW: 14454.6 Da PI: 8.4802 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 131.7 | 3.1e-41 | 10 | 109 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90
+Ca Ck+l+rkC+++C++apyfp ++p kf nvhk+FG snv+kll++lp+++r+da++s++yeA ar+rdPv+G+v+ i +lq+q++ l
Kaladp0016s0028.1.p 10 PCACCKFLKRKCPPECIFAPYFPPQDPYKFINVHKIFGSSNVSKLLNELPPHQRSDAVKSMAYEAAARVRDPVHGCVAEICSLQRQVQLL 99
7***************************************************************************************** PP
DUF260 91 kaelallkee 100
++el++++++
Kaladp0016s0028.1.p 100 QKELEAANAR 109
****998865 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 26.209 | 9 | 110 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 8.2E-41 | 10 | 107 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 129 aa Download sequence Send to blast |
MASSGFFDSP CACCKFLKRK CPPECIFAPY FPPQDPYKFI NVHKIFGSSN VSKLLNELPP 60 HQRSDAVKSM AYEAAARVRD PVHGCVAEIC SLQRQVQLLQ KELEAANARL RNYETLNNYP 120 AYSLPWNG* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 2e-51 | 8 | 113 | 9 | 114 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 2e-51 | 8 | 113 | 9 | 114 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021891897.1 | 9e-56 | LOB domain-containing protein 25 | ||||
| Refseq | XP_021891898.1 | 9e-56 | LOB domain-containing protein 25 | ||||
| Swissprot | Q9FML4 | 2e-54 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | A0A445G434 | 3e-54 | A0A445G434_GLYSO; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | K7MKN0 | 3e-54 | K7MKN0_SOYBN; Uncharacterized protein | ||||
| STRING | evm.model.supercontig_110.17 | 3e-55 | (Carica papaya) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63090.4 | 1e-56 | LBD family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Kaladp0016s0028.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




