![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Kaladp0024s0568.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 138aa MW: 15752.9 Da PI: 8.0274 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 166.9 | 2.5e-52 | 25 | 120 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91
+eq+r+lPianv+rimk++lP nakisk+aket+qecv+efisfvt+easdkc++e+rkt+ngdd++walatlGf++yv p++ yl+kyr
Kaladp0024s0568.1.p 25 KEQERLLPIANVGRIMKEILPPNAKISKEAKETLQECVTEFISFVTGEASDKCKKERRKTLNGDDICWALATLGFDNYVLPMRRYLSKYR 114
89**************************************************************************************** PP
NF-YB 92 elegek 97
e+egek
Kaladp0024s0568.1.p 115 EMEGEK 120
***996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.4E-49 | 22 | 125 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.02E-37 | 27 | 124 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 6.3E-27 | 30 | 94 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.6E-16 | 58 | 76 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 61 | 77 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.6E-16 | 77 | 95 | No hit | No description |
| PRINTS | PR00615 | 1.6E-16 | 96 | 114 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 138 aa Download sequence Send to blast |
MVDNGEPSNT SKNPRREEAV EYTIKEQERL LPIANVGRIM KEILPPNAKI SKEAKETLQE 60 CVTEFISFVT GEASDKCKKE RRKTLNGDDI CWALATLGFD NYVLPMRRYL SKYREMEGEK 120 LSSYNLGNSS HFQDRKS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 3e-41 | 24 | 115 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 3e-41 | 24 | 115 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007035553.2 | 9e-62 | PREDICTED: nuclear transcription factor Y subunit B-4 | ||||
| Swissprot | O82248 | 2e-54 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A061EW30 | 2e-60 | A0A061EW30_THECC; Nuclear transcription factor Y subunit B-5 | ||||
| STRING | EOY06479 | 3e-61 | (Theobroma cacao) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 9e-57 | nuclear factor Y, subunit B5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Kaladp0024s0568.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




