![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Kaladp0043s0005.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 71aa MW: 8283.7 Da PI: 9.535 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 58.2 | 2.8e-18 | 20 | 65 | 2 | 48 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
ppGfrFhPtdeel+ +yLk+kv g++l+l ++i+e+d+yk++P+dLp
Kaladp0043s0005.1.p 20 PPGFRFHPTDEELILYYLKRKVCGRRLKL-DMISETDVYKWDPEDLP 65
9****************************.99**************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 6.41E-20 | 15 | 68 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 19.921 | 19 | 70 | IPR003441 | NAC domain |
| Pfam | PF02365 | 4.7E-9 | 20 | 69 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 71 aa Download sequence Send to blast |
MKMPSSSSRC IGGKKKQVWP PGFRFHPTDE ELILYYLKRK VCGRRLKLDM ISETDVYKWD 60 PEDLPGTYFL * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 2e-14 | 20 | 65 | 16 | 61 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). Transcriptional activator that acts as positive regulator of AOX1A during mitochondrial dysfunction. Binds directly to AOX1A promoter. Mediates mitochondrial retrograde signaling. {ECO:0000269|PubMed:24045017}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By cold and drought stresses. {ECO:0000269|PubMed:17158162}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022158808.1 | 2e-28 | NAC domain-containing protein 17-like | ||||
| Swissprot | Q9XIC5 | 1e-19 | NAC17_ARATH; NAC domain-containing protein 17 | ||||
| TrEMBL | A0A438CHN0 | 6e-27 | A0A438CHN0_VITVI; NAC domain-containing protein 17 | ||||
| STRING | VIT_18s0001g01820.t01 | 1e-27 | (Vitis vinifera) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G34190.1 | 6e-22 | NAC domain containing protein 17 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Kaladp0043s0005.1.p |




