![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Kaladp0045s0271.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 123aa MW: 13416.2 Da PI: 10.2884 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 59.2 | 5.4e-19 | 80 | 114 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C +Cg+ kTp+WR gpdg+ktLCnaCG++y++ +l
Kaladp0045s0271.1.p 80 CKHCGSEKTPQWRAGPDGPKTLCNACGVRYKSGRL 114
*******************************9875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF57716 | 9.03E-13 | 73 | 111 | No hit | No description |
| PROSITE profile | PS50114 | 12.374 | 74 | 110 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 2.0E-11 | 74 | 122 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 1.3E-14 | 78 | 111 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 2.10E-10 | 79 | 116 | No hit | No description |
| Pfam | PF00320 | 8.7E-17 | 80 | 114 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 80 | 105 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 123 aa Download sequence Send to blast |
MRVQFLENSN SSFGSNNSNA VITICCSGRD LAPPIRRRCQ RGRFVDIPSQ KWFVWCSNIQ 60 PNKTGNGAAK TTSGITGRKC KHCGSEKTPQ WRAGPDGPKT LCNACGVRYK SGRLCPEYQS 120 TS* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022722855.1 | 3e-25 | GATA transcription factor 1-like | ||||
| Refseq | XP_022722856.1 | 3e-25 | GATA transcription factor 1-like | ||||
| Refseq | XP_022722857.1 | 3e-25 | GATA transcription factor 1-like | ||||
| Swissprot | Q8LAU9 | 2e-23 | GATA1_ARATH; GATA transcription factor 1 | ||||
| TrEMBL | A0A2R6R8Z8 | 7e-24 | A0A2R6R8Z8_ACTCH; GATA transcription factor | ||||
| TrEMBL | A0A2Z6NL07 | 4e-24 | A0A2Z6NL07_TRISU; Uncharacterized protein | ||||
| STRING | VIT_05s0051g00450.t01 | 2e-23 | (Vitis vinifera) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G24050.1 | 2e-25 | GATA transcription factor 1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Kaladp0045s0271.1.p |




