![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Kaladp0049s0010.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 84aa MW: 9273.43 Da PI: 4.0067 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 28.8 | 3.2e-09 | 40 | 76 | 1 | 37 |
HHHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHH CS
HSF_DNA-bind 1 aFlkklyeiledeelkeliswsengnsfvvldeeefa 37
+Fl+klyei++d++++ l++w +g+sfvv+d + f
Kaladp0049s0010.1.p 40 QFLSKLYEIVDDPNTDYLVQWGFDGQSFVVHDANAFC 76
69********************************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 1.7E-10 | 33 | 77 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 1.22E-8 | 37 | 77 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 5.8E-7 | 41 | 77 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 84 aa Download sequence Send to blast |
MVADVANIGQ GIDVVPSCFS QEVILPRPTH EKLREIGVPQ FLSKLYEIVD DPNTDYLVQW 60 GFDGQSFVVH DANAFCDYSS QVL* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Not induced by heat stress. {ECO:0000269|PubMed:18064488}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006651810.1 | 1e-14 | PREDICTED: LOW QUALITY PROTEIN: heat stress transcription factor A-2a-like | ||||
| Swissprot | Q84MN7 | 4e-15 | HFA2A_ORYSJ; Heat stress transcription factor A-2a | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G51910.1 | 1e-11 | heat shock transcription factor A7A | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Kaladp0049s0010.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




