![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Kaladp0053s0681.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 89aa MW: 10326 Da PI: 11.3788 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 47 | 6.1e-15 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg W+++Ed +l d++ G +W++I+++ g+ R +k+c++rw +yl
Kaladp0053s0681.1.p 14 RGLWSPDEDRKLRDYIINNGHACWSSIPAKAGLQRNGKSCRLRWINYL 61
789*******************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.2E-21 | 6 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 21.339 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.6E-9 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 4.7E-13 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 9.61E-19 | 16 | 88 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 4.94E-8 | 17 | 61 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 4.6E-7 | 65 | 88 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 7.402 | 66 | 88 | IPR017930 | Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MGHKPNHQKV KHRRGLWSPD EDRKLRDYII NNGHACWSSI PAKAGLQRNG KSCRLRWINY 60 LRPGLKRGAF TLEEREIVLT LHRMLGNK* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020549243.1 | 9e-43 | transcription factor LAF1-like | ||||
| Swissprot | Q9M0K4 | 3e-36 | LAF1_ARATH; Transcription factor LAF1 | ||||
| TrEMBL | A0A199V6S2 | 1e-40 | A0A199V6S2_ANACO; Transcription factor LAF1 (Fragment) | ||||
| TrEMBL | A0A2I0VMC8 | 1e-40 | A0A2I0VMC8_9ASPA; Transcription factor LAF1 | ||||
| STRING | EOY23173 | 2e-41 | (Theobroma cacao) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G25560.1 | 1e-38 | myb domain protein 18 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Kaladp0053s0681.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




