![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Kaladp0058s0445.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 68aa MW: 7221.68 Da PI: 11.1308 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 125.8 | 1.3e-39 | 5 | 67 | 8 | 70 |
S1FA 8 akGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
+G+n Glivllvv gll++flvgny+lyvyaqk+lPPrkkkPvskkklkre+lkqGv++PGe
Kaladp0058s0445.1.p 5 GQGFNAGLIVLLVVVGLLVTFLVGNYVLYVYAQKTLPPRKKKPVSKKKLKRERLKQGVSAPGE 67
589***********************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04689 | 5.1E-38 | 5 | 67 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 68 aa Download sequence Send to blast |
ANAGGQGFNA GLIVLLVVVG LLVTFLVGNY VLYVYAQKTL PPRKKKPVSK KKLKRERLKQ 60 GVSAPGE* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010104121.2 | 9e-28 | DNA-binding protein S1FA | ||||
| Refseq | XP_024026346.1 | 9e-28 | DNA-binding protein S1FA | ||||
| Swissprot | P42553 | 3e-12 | S1FA1_ORYSJ; DNA-binding protein S1FA1 | ||||
| Swissprot | Q7XLX6 | 4e-12 | S1FA2_ORYSJ; DNA-binding protein S1FA2 | ||||
| TrEMBL | W9SCA3 | 4e-26 | W9SCA3_9ROSA; DNA-binding protein S1FA1 | ||||
| STRING | XP_010104121.1 | 6e-27 | (Morus notabilis) | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Kaladp0058s0445.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




