![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Kaladp0065s0043.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 78aa MW: 8841.1 Da PI: 8.8937 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 93.2 | 2.4e-29 | 2 | 76 | 14 | 88 |
NF-YB 14 srimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88
+rimk vlP+nakisk+ake +qe ++efisfvtse+sdkc++++rkt+ngd+++ al +l f++ e+ + yl
Kaladp0065s0043.1.p 2 GRIMKLVLPQNAKISKAAKERMQEYATEFISFVTSETSDKCRKDNRKTVNGDNICRALNHLEFDNLGESPTRYLC 76
7****************************************************************9999888885 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00808 | 2.6E-17 | 2 | 59 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| SuperFamily | SSF47113 | 1.66E-22 | 2 | 75 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 9.4E-28 | 2 | 75 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 6.0E-7 | 23 | 41 | No hit | No description |
| PRINTS | PR00615 | 6.0E-7 | 42 | 60 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 78 aa Download sequence Send to blast |
MGRIMKLVLP QNAKISKAAK ERMQEYATEF ISFVTSETSD KCRKDNRKTV NGDNICRALN 60 HLEFDNLGES PTRYLCN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 7e-25 | 1 | 75 | 13 | 87 | Transcription factor HapC (Eurofung) |
| 4g92_B | 7e-25 | 1 | 75 | 13 | 87 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024190877.1 | 1e-31 | nuclear transcription factor Y subunit B-4 | ||||
| Swissprot | O82248 | 3e-26 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A2P6R739 | 2e-30 | A0A2P6R739_ROSCH; Putative transcription factor Hap3/NF-YB family | ||||
| STRING | EMJ08835 | 1e-30 | (Prunus persica) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 1e-28 | nuclear factor Y, subunit B5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Kaladp0065s0043.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




