PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Kaladp0096s0027.1.p

Organism

Kalanchoe laxiflora

Taxonomic ID

1670617

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe

Family

MYB_related

Protein Properties

Length: 110aa MW: 12752.7 Da PI: 9.9532

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Kaladp0096s0027.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	48.6	1.8e-15	58	102	2	48
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g++++eE++l+ +++k+lG+ W++Ia +++ gRt++++k++w+ +l Kaladp0096s0027.1.p 58 GNMSEEEEDLIQRLHKLLGNI-WSLIAGRLP-GRTDNEIKNYWNLHL 102 789**************99.*****.*********9875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50090	4.728	1	51	IPR017877	Myb-like domain
SuperFamily	SSF46689	1.71E-20	37	105	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	5.6E-11	37	63	IPR009057	Homeodomain-like
PROSITE profile	PS51294	21.261	52	106	IPR017930	Myb domain
SMART	SM00717	1.2E-14	56	104	IPR001005	SANT/Myb domain
Pfam	PF00249	7.9E-14	58	102	IPR001005	SANT/Myb domain
CDD	cd00167	6.50E-11	59	102	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.0E-19	64	103	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 110 aa Download sequence Send to blast
MAHFHFVRRH GQQPVVTFYI PWCFFCNADG APFAGLNRSG KSCRLRWLNY LKPDIKSGNM 60 SEEEEDLIQR LHKLLGNIWS LIAGRLPGRT DNEIKNYWNL HLKKRVLGD*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	1e-19	38	106	40	108	B-MYB
Search in ModeBase

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18541146, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008364573.2	3e-38	transcription repressor MYB5-like
Refseq	XP_010261928.1	3e-38	PREDICTED: transcription factor MYB114-like
Swissprot	Q9S9K9	1e-34	MYB3_ARATH; Transcription factor MYB3
TrEMBL	A0A199UZY2	2e-37	A0A199UZY2_ANACO; Transcription factor TT2
STRING	XP_008356551.1	1e-37	(Malus domestica)
STRING	XP_008364573.1	1e-37	(Malus domestica)
STRING	XP_010261928.1	1e-37	(Nelumbo nucifera)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22640.1	5e-37	myb domain protein 3

Link Out ? help Back to Top
Phytozome	Kaladp0096s0027.1.p

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]