| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | WRKY | 103.9 | 8.6e-33 | 179 | 237 | 1 | 60 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60
ldDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers +++++ei+Y+g+Hnh+k
Kalax.0055s0008.1.p 179 LDDGYNWRKYGQKSVKGSENPRSYYKCTFTNCPTKKKVERSL-EGHITEIVYKGSHNHPK 237
59****************************************.***************85 PP
|
| 2 | WRKY | 105.9 | 2.1e-33 | 334 | 392 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+++d k v++tYeg+Hnh+
Kalax.0055s0008.1.p 334 LDDGYRWRKYGQKVVKGNPNPRSYYKCTFVGCPVRKHVERASQDLKSVITTYEGKHNHD 392
59********************************************************7 PP
|
| Publications
? help Back to Top |
- Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821] - Brand LH, et al.
Screening for protein-DNA interactions by automatable DNA-protein interaction ELISA. PLoS ONE, 2013. 8(10): p. e75177 [PMID:24146751] - Ali MA,Wieczorek K,Kreil DP,Bohlmann H
The beet cyst nematode Heterodera schachtii modulates the expression of WRKY transcription factors in syncytia to favour its development in Arabidopsis roots. PLoS ONE, 2014. 9(7): p. e102360 [PMID:25033038] - Divi UK,Rahman T,Krishna P
Gene expression and functional analyses in brassinosteroid-mediated stress tolerance. Plant Biotechnol. J., 2016. 14(1): p. 419-32 [PMID:25973891] - Peskan-Berghöfer T, et al.
Sustained exposure to abscisic acid enhances the colonization potential of the mutualist fungus Piriformospora indica on Arabidopsis thaliana roots. New Phytol., 2015. 208(3): p. 873-86 [PMID:26075497] - Wang C, et al.
The Arabidopsis Mediator Complex Subunit16 Is a Key Component of Basal Resistance against the Necrotrophic Fungal Pathogen Sclerotinia sclerotiorum. Plant Physiol., 2015. 169(1): p. 856-72 [PMID:26143252] - Wang C, et al.
Arabidopsis Elongator subunit 2 positively contributes to resistance to the necrotrophic fungal pathogens Botrytis cinerea and Alternaria brassicicola. Plant J., 2015. 83(6): p. 1019-33 [PMID:26216741] - Datta R, et al.
Glutathione Regulates 1-Aminocyclopropane-1-Carboxylate Synthase Transcription via WRKY33 and 1-Aminocyclopropane-1-Carboxylate Oxidase by Modulating Messenger RNA Stability to Induce Ethylene Synthesis during Stress. Plant Physiol., 2015. 169(4): p. 2963-81 [PMID:26463088] - Daumann M,Fischer M,Niopek-Witz S,Girke C,Möhlmann T
Apoplastic Nucleoside Accumulation in Arabidopsis Leads to Reduced Photosynthetic Performance and Increased Susceptibility Against Botrytis cinerea. Front Plant Sci, 2015. 6: p. 1158 [PMID:26779190] - Liu S,Bartnikas LM,Volko SM,Ausubel FM,Tang D
Mutation of the Glucosinolate Biosynthesis Enzyme Cytochrome P450 83A1 Monooxygenase Increases Camalexin Accumulation and Powdery Mildew Resistance. Front Plant Sci, 2016. 7: p. 227 [PMID:26973671] - Jiang Y,Yu D
The WRKY57 Transcription Factor Affects the Expression of Jasmonate ZIM-Domain Genes Transcriptionally to Compromise Botrytis cinerea Resistance. Plant Physiol., 2016. 171(4): p. 2771-82 [PMID:27268959] - Liao CJ,Lai Z,Lee S,Yun DJ,Mengiste T
Arabidopsis HOOKLESS1 Regulates Responses to Pathogens and Abscisic Acid through Interaction with MED18 and Acetylation of WRKY33 and ABI5 Chromatin. Plant Cell, 2016. 28(7): p. 1662-81 [PMID:27317674] - Birkenbihl RP,Kracher B,Roccaro M,Somssich IE
Induced Genome-Wide Binding of Three Arabidopsis WRKY Transcription Factors during Early MAMP-Triggered Immunity. Plant Cell, 2017. 29(1): p. 20-38 [PMID:28011690] - Nguyen CC, et al.
Overexpression of oligouridylate binding protein 1b results in ABA hypersensitivity. Plant Signal Behav, 2017. 12(2): p. e1282591 [PMID:28112571] - Liu S,Ziegler J,Zeier J,Birkenbihl RP,Somssich IE
Botrytis cinerea B05.10 promotes disease development in Arabidopsis by suppressing WRKY33-mediated host immunity. Plant Cell Environ., 2017. 40(10): p. 2189-2206 [PMID:28708934] - D'Ambrosio JM, et al.
Phospholipase C2 Affects MAMP-Triggered Immunity by Modulating ROS Production. Plant Physiol., 2017. 175(2): p. 970-981 [PMID:28827453] - Liu F, et al.
Interactions of WRKY15 and WRKY33 transcription factors and their roles in the resistance of oilseed rape to Sclerotinia infection. Plant Biotechnol. J., 2018. 16(4): p. 911-925 [PMID:28929638] - Crespo-Salvador Ó,Escamilla-Aguilar M,López-Cruz J,López-Rodas G,González-Bosch C
Determination of histone epigenetic marks in Arabidopsis and tomato genes in the early response to Botrytis cinerea. Plant Cell Rep., 2018. 37(1): p. 153-166 [PMID:29119291]
|