![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Kalax.0106s0064.3.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 132aa MW: 14630.5 Da PI: 6.7747 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 179.5 | 3e-56 | 27 | 120 | 1 | 94 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90
vreqdrflPian+srimkk+lPan+ki+kdaketvqecvsefisfvtseasdkc rekrkt+ngddllwa+atlGfedy++pl+vyl++y
Kalax.0106s0064.3.p 27 VREQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFVTSEASDKCLREKRKTVNGDDLLWAMATLGFEDYIDPLRVYLNRY 116
69**************************************************************************************** PP
NF-YB 91 rele 94
re++
Kalax.0106s0064.3.p 117 REVH 120
**85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 5.2E-51 | 23 | 120 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 6.99E-38 | 30 | 120 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.0E-27 | 33 | 97 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.6E-19 | 61 | 79 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 64 | 80 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.6E-19 | 80 | 98 | No hit | No description |
| PRINTS | PR00615 | 1.6E-19 | 99 | 117 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 132 aa Download sequence Send to blast |
MAEAPASPGG GGSHDSGGDQ SPRSSNVREQ DRFLPIANIS RIMKKALPAN GKIAKDAKET 60 VQECVSEFIS FVTSEASDKC LREKRKTVNG DDLLWAMATL GFEDYIDPLR VYLNRYREVH 120 LTCHSQLFFF F* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 5e-46 | 28 | 118 | 3 | 93 | NF-YB |
| 4awl_B | 5e-46 | 28 | 118 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 5e-46 | 28 | 118 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010920928.1 | 5e-76 | nuclear transcription factor Y subunit B isoform X2 | ||||
| Refseq | XP_029120279.1 | 9e-76 | nuclear transcription factor Y subunit B-1 isoform X1 | ||||
| Swissprot | Q8VYK4 | 2e-71 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A251NV35 | 3e-75 | A0A251NV35_PRUPE; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400004366 | 4e-75 | (Solanum tuberosum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G53340.1 | 1e-63 | nuclear factor Y, subunit B10 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Kalax.0106s0064.3.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




