![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Kalax.0159s0042.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 120aa MW: 13829.9 Da PI: 10.5944 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 104.1 | 7.7e-33 | 34 | 92 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK vk+s+fprsYYrCt++gC+vkk+v+r a+d+ vv++tYeg H h+
Kalax.0159s0042.1.p 34 LDDGYRWRKYGQKAVKNSTFPRSYYRCTHPGCHVKKQVQRMAKDKGVVTTTYEGVHSHP 92
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 8.1E-34 | 19 | 92 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 1.07E-29 | 26 | 93 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 28.725 | 29 | 94 | IPR003657 | WRKY domain |
| SMART | SM00774 | 7.2E-36 | 34 | 93 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 2.3E-26 | 35 | 92 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 120 aa Download sequence Send to blast |
MRMLGVNSNC SKRCEKKARK PRYAFQTRSA VDILDDGYRW RKYGQKAVKN STFPRSYYRC 60 THPGCHVKKQ VQRMAKDKGV VTTTYEGVHS HPIQKPADNF ESMLRQMQIY NPSLNPTSV* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 1e-27 | 24 | 93 | 7 | 76 | Probable WRKY transcription factor 4 |
| 2lex_A | 1e-27 | 24 | 93 | 7 | 76 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021658398.1 | 3e-57 | probable WRKY transcription factor 75 isoform X2 | ||||
| Swissprot | Q9FYA2 | 1e-48 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
| TrEMBL | A0A059Q918 | 6e-56 | A0A059Q918_GOSHI; WRKY transcription factor 60 | ||||
| STRING | Gorai.001G273100.1 | 1e-56 | (Gossypium raimondii) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13080.1 | 6e-51 | WRKY DNA-binding protein 75 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Kalax.0159s0042.1.p |




