![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Kalax.0279s0029.2.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 79aa MW: 8790.27 Da PI: 10.1964 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 92.2 | 2.5e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krie+k rqvtfskR+ g++KKA+ELSvLCd++va+ ifss+gk+yeyss
Kalax.0279s0029.2.p 9 KRIEDKNSRQVTFSKRKSGLMKKANELSVLCDVDVALFIFSSKGKMYEYSS 59
79***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.1E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 30.992 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.31E-33 | 2 | 61 | No hit | No description |
| SuperFamily | SSF55455 | 6.93E-30 | 2 | 69 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.8E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 5.3E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.8E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.8E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 79 aa Download sequence Send to blast |
MGRGKVELKR IEDKNSRQVT FSKRKSGLMK KANELSVLCD VDVALFIFSS KGKMYEYSSG 60 SRCVCKSFYG KIKDPVGE* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6bz1_A | 2e-20 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| 6bz1_B | 2e-20 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| 6bz1_C | 2e-20 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| 6bz1_D | 2e-20 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024969696.1 | 2e-28 | truncated transcription factor CAULIFLOWER A-like isoform X1 | ||||
| Refseq | XP_024969701.1 | 3e-28 | truncated transcription factor CAULIFLOWER A-like isoform X2 | ||||
| Swissprot | Q41274 | 1e-25 | AGL8_SINAL; Agamous-like MADS-box protein AGL8 homolog | ||||
| TrEMBL | A0A2P5B948 | 3e-28 | A0A2P5B948_PARAD; MADS-box transcription factor | ||||
| STRING | VIT_14s0068g01800.t01 | 2e-27 | (Vitis vinifera) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G60910.1 | 1e-27 | AGAMOUS-like 8 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Kalax.0279s0029.2.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




