PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Kalax.0294s0006.1.p

Organism

Kalanchoe marnieriana

Taxonomic ID

80907

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe

Family

WOX

Protein Properties

Length: 124aa MW: 13825 Da PI: 11.0504

Description

WOX family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Kalax.0294s0006.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	53.7	3.5e-17	14	75	1	57
TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 r R+++t eq++ Leel++ +p+a ++ ++ ++l +++ ++V++WFqN++a++k+ Kalax.0294s0006.1.p 14 RAARWCPTGEQVTLLEELYKGgLTNPTAGQIHQIVAHLsrfgKVQGKNVFYWFQNHKARDKQ 75 568***************99************************************97 PP
2	Wus_type_Homeobox	104.5	6.9e-34	15	76	3	64
Wus_type_Homeobox 3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 +RW+Pt eQ+++Leelyk Gl +P++ +i++i a+L+++Gk+++kNVfyWFQN+kaR++q+ Kalax.0294s0006.1.p 15 AARWCPTGEQVTLLEELYKGGLTNPTAGQIHQIVAHLSRFGKVQGKNVFYWFQNHKARDKQR 76 57**********************************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50071	8.892	11	76	IPR001356	Homeobox domain
SMART	SM00389	0.0034	13	80	IPR001356	Homeobox domain
Pfam	PF00046	6.8E-15	14	75	IPR001356	Homeobox domain
SuperFamily	SSF46689	8.98E-11	14	80	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	6.5E-6	17	75	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 124 aa Download sequence Send to blast
MCPAVGTGGA GCIRAARWCP TGEQVTLLEE LYKGGLTNPT AGQIHQIVAH LSRFGKVQGK 60 NVFYWFQNHK ARDKQRVRKT LAGRWWLQWW RRPDMTSTSA PLRRQSIPVP GHPLPISCHC 120 PPA*

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in the lateral sepal axis-dependent development of flowers, probably by regulating the proliferation of L1 cells at the lateral region of flower primordia. Required for the formation of the margin cells of the first and second whorl organs. {ECO:0000269\|PubMed:11751640, ECO:0000269\|PubMed:15169755}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021975839.1	3e-29	WUSCHEL-related homeobox 3-like
Swissprot	Q9SIB4	1e-27	WOX3_ARATH; WUSCHEL-related homeobox 3
TrEMBL	A0A2U1L666	1e-28	A0A2U1L666_ARTAN; Homeodomain-containing protein
TrEMBL	A0A2U1PTR4	1e-28	A0A2U1PTR4_ARTAN; Homeodomain-containing protein
STRING	Aquca_046_00011.1	3e-27	(Aquilegia coerulea)
STRING	VIT_06s0004g03780.t01	7e-28	(Vitis vinifera)
STRING	evm.model.supercontig_139.11	3e-27	(Carica papaya)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G28610.1	5e-30	WOX family protein

Link Out ? help Back to Top
Phytozome	Kalax.0294s0006.1.p

Publications ? help Back to Top
Chandler JW,Werr W Arabidopsis floral phytomer development: auxin response relative to biphasic modes of organ initiation. J. Exp. Bot., 2014. 65(12): p. 3097-110 [PMID:24744428] Niu L, et al. LOOSE FLOWER, a WUSCHEL-like Homeobox gene, is required for lateral fusion of floral organs in Medicago truncatula. Plant J., 2015. 81(3): p. 480-92 [PMID:25492397] Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL Active suppression of a leaf meristem orchestrates determinate leaf growth. Elife, 2017. [PMID:27710768] Guan C, et al. Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis. Curr. Biol., 2017. 27(19): p. 2940-2950.e4 [PMID:28943086]