PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Kalax.0381s0031.1.p

Organism

Kalanchoe marnieriana

Taxonomic ID

80907

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe

Family

SBP

Protein Properties

Length: 218aa MW: 24124.2 Da PI: 10.1592

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Kalax.0381s0031.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	132	2e-41	67	142	1	76
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 +Cqv+gC++dl+++k y++rhkvC +hsk++vv+v g+++rfCqqCsrfh+l efD+ekrsCrrrLa+hnerrrk+ Kalax.0381s0031.1.p 67 TCQVHGCNVDLTHVKAYYSRHKVCIMHSKSAVVTVGGVQKRFCQQCSRFHQLPEFDQEKRSCRRRLAGHNERRRKP 142 6*************************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	1.3E-31	63	129	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	31.026	65	142	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	2.88E-39	66	144	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	3.3E-31	68	141	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 218 aa Download sequence Send to blast
MAMSSSSITD SPNSSESLNG LTIGHKIYFE DVGVAAMPKS ANASSFPAAS PSKKMKPATS 60 RLQHPPTCQV HGCNVDLTHV KAYYSRHKVC IMHSKSAVVT VGGVQKRFCQ QCSRFHQLPE 120 FDQEKRSCRR RLAGHNERRR KPPPVSLLSS RYGTSSIFDT NNHGRGFLLD FSKNSGMPDM 180 DGHASSGDRR SILQTQVIGK FLMQPWTNSS ENPPSDHY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	6e-29	68	141	11	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305\|PubMed:12202040}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022935374.1	9e-71	squamosa promoter-binding-like protein 17 isoform X1
Swissprot	Q700W2	2e-43	SPL9_ARATH; Squamosa promoter-binding-like protein 9
TrEMBL	A0A0A0LBC1	2e-68	A0A0A0LBC1_CUCSA; Uncharacterized protein
TrEMBL	A0A1S3B7Z5	2e-68	A0A1S3B7Z5_CUCME; squamosa promoter-binding-like protein 9 isoform X1
STRING	XP_008443072.1	3e-69	(Cucumis melo)
STRING	XP_004136576.1	3e-69	(Cucumis sativus)
STRING	XP_004161490.1	3e-69	(Cucumis sativus)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G42200.1	6e-44	squamosa promoter binding protein-like 9

Link Out ? help Back to Top
Phytozome	Kalax.0381s0031.1.p

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Stief A, et al. Arabidopsis miR156 Regulates Tolerance to Recurring Environmental Stress through SPL Transcription Factors. Plant Cell, 2014. 26(4): p. 1792-1807 [PMID:24769482] Yu ZX, et al. Progressive Regulation of Sesquiterpene Biosynthesis in Arabidopsis and Patchouli (Pogostemon cablin) by the miR156-Targeted SPL Transcription Factors. Mol Plant, 2015. [PMID:25355059] Yu N,Niu QW,Ng KH,Chua NH The role of miR156/SPLs modules in Arabidopsis lateral root development. Plant J., 2015. 83(4): p. 673-85 [PMID:26096676] Morea EG, et al. Functional and evolutionary analyses of the miR156 and miR529 families in land plants. BMC Plant Biol., 2016. 16: p. 40 [PMID:26841873] Hyun Y, et al. Multi-layered Regulation of SPL15 and Cooperation with SOC1 Integrate Endogenous Flowering Pathways at the Arabidopsis Shoot Meristem. Dev. Cell, 2016. 37(3): p. 254-66 [PMID:27134142] Xu M, et al. Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana. PLoS Genet., 2016. 12(8): p. e1006263 [PMID:27541584] Mahmood K,Xu Z,El-Kereamy A,Casaretto JA,Rothstein SJ The Arabidopsis Transcription Factor ANAC032 Represses Anthocyanin Biosynthesis in Response to High Sucrose and Oxidative and Abiotic Stresses. Front Plant Sci, 2016. 7: p. 1548 [PMID:27790239] Mao YB, et al. Jasmonate response decay and defense metabolite accumulation contributes to age-regulated dynamics of plant insect resistance. Nat Commun, 2017. 8: p. 13925 [PMID:28067238] Nguyen ST,Greaves T,McCurdy DW Heteroblastic Development of Transfer Cells Is Controlled by the microRNA miR156/SPL Module. Plant Physiol., 2017. 173(3): p. 1676-1691 [PMID:28082719] Duan HC, et al. ALKBH10B Is an RNA N6-Methyladenosine Demethylase Affecting Arabidopsis Floral Transition. Plant Cell, 2017. 29(12): p. 2995-3011 [PMID:29180595] Dotto M,Gómez MS,Soto MS,Casati P UV-B radiation delays flowering time through changes in the PRC2 complex activity and miR156 levels in Arabidopsis thaliana. Plant Cell Environ., 2018. 41(6): p. 1394-1406 [PMID:29447428] He J, et al. Threshold-dependent repression of SPL gene expression by miR156/miR157 controls vegetative phase change in Arabidopsis thaliana. PLoS Genet., 2018. 14(4): p. e1007337 [PMID:29672610]