![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Kalax.0412s0024.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 86aa MW: 9653.37 Da PI: 11.0688 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 45.8 | 8.4e-15 | 44 | 77 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
C Cg t+Tp W rgp+g+ tLCn CGl++ ++
Kalax.0412s0024.1.p 44 CKECGRTETPTWLRGPSGPQTLCNRCGLRFSREQ 77
9*****************************9876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50114 | 10.66 | 38 | 71 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 8.7E-6 | 38 | 85 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 1.66E-11 | 41 | 77 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 5.1E-13 | 42 | 79 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 4.67E-8 | 43 | 73 | No hit | No description |
| Pfam | PF00320 | 5.3E-12 | 44 | 76 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 86 aa Download sequence Send to blast |
MGEKMGNKLI PHLNWVFPNF TKKPKISNPK PKSKPQMAVL SRICKECGRT ETPTWLRGPS 60 GPQTLCNRCG LRFSREQKKA KNAET* |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G36620.1 | 2e-12 | GATA transcription factor 19 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Kalax.0412s0024.1.p |




