![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Kalax.0862s0017.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 76aa MW: 8095.66 Da PI: 10.7197 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 125.1 | 2.2e-39 | 9 | 75 | 4 | 70 |
S1FA 4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
+++ +G+n Glivllvv g+l++flvgny+lyvyaqk+lPPrkkkPvskkklkre+lkqGv++PGe
Kalax.0862s0017.1.p 9 VNAGGQGFNAGLIVLLVVVGILVTFLVGNYVLYVYAQKTLPPRKKKPVSKKKLKRERLKQGVSAPGE 75
455569************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04689 | 1.4E-37 | 13 | 75 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 76 aa Download sequence Send to blast |
MDDDLGAKVN AGGQGFNAGL IVLLVVVGIL VTFLVGNYVL YVYAQKTLPP RKKKPVSKKK 60 LKRERLKQGV SAPGE* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010104121.2 | 2e-27 | DNA-binding protein S1FA | ||||
| Refseq | XP_024026346.1 | 2e-27 | DNA-binding protein S1FA | ||||
| Swissprot | Q7XLX6 | 5e-12 | S1FA2_ORYSJ; DNA-binding protein S1FA2 | ||||
| TrEMBL | W9SCA3 | 6e-26 | W9SCA3_9ROSA; DNA-binding protein S1FA1 | ||||
| STRING | XP_010104121.1 | 1e-26 | (Morus notabilis) | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Kalax.0862s0017.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




