PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Kalax.1191s0008.1.p

Organism

Kalanchoe marnieriana

Taxonomic ID

80907

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe

Family

NF-YB

Protein Properties

Length: 173aa MW: 18977.2 Da PI: 5.6342

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Kalax.1191s0008.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	173.2	2.8e-54	26	121	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 ++ dr+lPianvsr+mkk lP nakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyv pl+ yl+kyr Kalax.1191s0008.1.p 26 KDPDRLLPIANVSRLMKKSLPMNAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVGPLRSYLSKYR 115 678************************************************************************************* PP NF-YB 92 elegek 97 eleg+k Kalax.1191s0008.1.p 116 ELEGDK 121 **97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	2.1E-52	21	138	IPR009072	Histone-fold
SuperFamily	SSF47113	4.35E-40	29	134	IPR009072	Histone-fold
Pfam	PF00808	2.7E-26	31	95	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	5.7E-19	59	77	No hit	No description
PROSITE pattern	PS00685	0	62	78	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	5.7E-19	78	96	No hit	No description
PRINTS	PR00615	5.7E-19	97	115	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 173 aa Download sequence Send to blast
TSSIMTGKRA NPSSPPLSPT DQTSSKDPDR LLPIANVSRL MKKSLPMNAK ISKEAKETVQ 60 ECVSEFISFI TGEASDKCQR EKRKTINGDD LLWAMTTLGF EDYVGPLRSY LSKYRELEGD 120 KSSIAKQDQE ADANGHMGDH DGHLGVEDFV DKYQYLLSAN GGGGELHHGV QW*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	3e-45	26	116	2	92	Transcription factor HapC (Eurofung)
4g92_B	3e-45	26	116	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT091494	4e-47	BT091494.1 Soybean clone JCVI-FLGm-8I21 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020215519.1	1e-66	nuclear transcription factor Y subunit B-3
Swissprot	O23310	2e-58	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBL	A0A151TKQ3	3e-65	A0A151TKQ3_CAJCA; Nuclear transcription factor Y subunit B-3
STRING	XP_006493850.1	3e-65	(Citrus sinensis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	7e-61	nuclear factor Y, subunit B3

Link Out ? help Back to Top
Phytozome	Kalax.1191s0008.1.p

Publications ? help Back to Top
Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]