![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Kalax.1298s0001.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 94aa MW: 10628.3 Da PI: 10.2003 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 51.1 | 3e-16 | 19 | 66 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+W+ eEd +lv +v+++G +W+ ++ g+ R++k+c++rw++yl
Kalax.1298s0001.1.p 19 KGAWSVEEDIKLVAYVTKYGCWNWRQLPKFAGLARCGKSCRLRWLNYL 66
79******************99*************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 21.757 | 14 | 70 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 7.8E-21 | 15 | 69 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 8.8E-9 | 18 | 68 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 5.4E-14 | 19 | 66 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.05E-21 | 20 | 93 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 5.23E-8 | 21 | 66 | No hit | No description |
| PROSITE profile | PS50090 | 4.716 | 67 | 93 | IPR017877 | Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 1.0E-8 | 70 | 93 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 94 aa Download sequence Send to blast |
MGRRPATATA AAIDSGLRKG AWSVEEDIKL VAYVTKYGCW NWRQLPKFAG LARCGKSCRL 60 RWLNYLKPDL KRGNYTKEEE DTIIRLHESV GNK* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 6e-15 | 12 | 93 | 20 | 100 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. {ECO:0000250|UniProtKB:Q9M2D9}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by gravity in roots. {ECO:0000269|PubMed:24902892}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021901070.1 | 8e-46 | transcription factor MYB4-like | ||||
| Swissprot | Q9SBF3 | 8e-35 | MYB92_ARATH; Transcription factor MYB92 | ||||
| TrEMBL | A0A1R3JCN6 | 4e-44 | A0A1R3JCN6_COCAP; Uncharacterized protein | ||||
| STRING | evm.model.supercontig_34.62 | 3e-45 | (Carica papaya) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G10280.1 | 3e-37 | myb domain protein 92 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Kalax.1298s0001.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




