![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Kalax.1326s0008.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 128aa MW: 14261 Da PI: 10.1338 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 93.3 | 3e-29 | 50 | 106 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep++VNaKQy++Il+RRq R k+e+e+kl +ksrk+ylheSRh hAlrR+Rg+ G F
Kalax.1326s0008.1.p 50 EEPVFVNAKQYHGILRRRQPRGKAESENKL-AKSRKQYLHESRHPHALRRARGCAGCF 106
69****************************.***********************9977 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 1.4E-31 | 48 | 109 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 33.237 | 49 | 109 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 9.7E-25 | 51 | 106 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 6.6E-20 | 52 | 74 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 6.6E-20 | 83 | 106 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 128 aa Download sequence Send to blast |
HNPYYRSIFT SHEAPPYSAQ PYSPQPMVCP HAAYVGIQQA GLPLPSDVVE EPVFVNAKQY 60 HGILRRRQPR GKAESENKLA KSRKQYLHES RHPHALRRAR GCAGCFLNAK KNENNQKNES 120 TSGGSSH* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 1e-19 | 49 | 114 | 1 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021903689.1 | 2e-56 | nuclear transcription factor Y subunit A-7-like isoform X1 | ||||
| Refseq | XP_021903693.1 | 2e-56 | nuclear transcription factor Y subunit A-7-like isoform X3 | ||||
| Refseq | XP_021903694.1 | 2e-56 | nuclear transcription factor Y subunit A-7-like isoform X3 | ||||
| Refseq | XP_021903695.1 | 2e-56 | nuclear transcription factor Y subunit A-7-like isoform X3 | ||||
| Swissprot | Q84JP1 | 2e-44 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
| TrEMBL | B9SB33 | 2e-54 | B9SB33_RICCO; Nuclear transcription factor Y subunit A-4, putative | ||||
| STRING | evm.model.supercontig_20.45 | 2e-56 | (Carica papaya) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G30500.1 | 8e-39 | nuclear factor Y, subunit A7 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Kalax.1326s0008.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




