![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | LOC_Os01g24070.1 | ||||||||
| Common Name | B1045F02.28, LOC4326489, Os01g0343300, OSNPB_010343300 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 132aa MW: 14138 Da PI: 9.5313 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 61.8 | 8.5e-20 | 21 | 55 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C+ C++t+Tp+WR+gp g+++LCnaCG++yrkk++
LOC_Os01g24070.1 21 CVECRATTTPMWRSGPTGPRSLCNACGIRYRKKRR 55
********************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50114 | 12.848 | 15 | 51 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 2.6E-15 | 15 | 65 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 2.52E-13 | 18 | 55 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 3.7E-16 | 19 | 56 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 1.71E-13 | 20 | 56 | No hit | No description |
| PROSITE pattern | PS00344 | 0 | 21 | 46 | IPR000679 | Zinc finger, GATA-type |
| Pfam | PF00320 | 1.5E-17 | 21 | 55 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0030154 | Biological Process | cell differentiation | ||||
| GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005667 | Cellular Component | transcription factor complex | ||||
| GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
| GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding | ||||
| GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding | ||||
| GO:0003682 | Molecular Function | chromatin binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0007042 | developmental stage | whole plant fruit formation stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 132 aa Download sequence Send to blast |
MGSTDRKVVG IGVAEEGRRS CVECRATTTP MWRSGPTGPR SLCNACGIRY RKKRRQDLGL 60 DLNQPQKQEH GEVIPEVKDS NSNSNNCNSG SGNSSSNLQV VPKRRLLMGV EEAALLLMTL 120 SSPSASTLLH G* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Os.21239 | 0.0 | callus| leaf| panicle| stem | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 116639665 | 0.0 | ||||
| Expression Atlas | Q8LQW5 | - | ||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | LOC_Os01g24070.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| RiceGE | Os01g24070 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT132400 | 0.0 | BT132400.1 Oryza sativa clone RRlibD00393 mRNA sequence. | |||
| GenBank | CT829626 | 0.0 | CT829626.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA214F08, full insert sequence. | |||
| GenBank | CT841570 | 0.0 | CT841570.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C102C07, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015621366.1 | 7e-92 | GATA transcription factor 23 | ||||
| TrEMBL | A0A0E0MVX1 | 2e-90 | A0A0E0MVX1_ORYRU; Uncharacterized protein | ||||
| TrEMBL | A0A2I4KW69 | 2e-90 | A0A2I4KW69_ORYSI; GATA transcription factor | ||||
| TrEMBL | Q8LQW5 | 2e-90 | Q8LQW5_ORYSJ; Os01g0343300 protein | ||||
| STRING | ORUFI01G16060.1 | 3e-91 | (Oryza rufipogon) | ||||
| STRING | OS01T0343300-01 | 3e-91 | (Oryza sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP6721 | 28 | 54 | Representative plant | OGRP68 | 17 | 287 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26930.1 | 3e-18 | GATA transcription factor 23 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | LOC_Os01g24070.1 |
| Entrez Gene | 4326489 |




