![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | LOC_Os01g66120.3 | ||||||||
| Common Name | B1065E10.51, LOC4325006, NAC48, NAC6, Os01g0884300 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 248aa MW: 26472.2 Da PI: 9.6984 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 96.9 | 3.1e-30 | 5 | 77 | 54 | 128 |
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
+ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk+v s + v +kk Lvfy g+apkgekt+W+mheyrl
LOC_Os01g66120.3 5 GEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVGS--PKPVAIKKALVFYAGKAPKGEKTNWIMHEYRL 77
579************************************99..789***************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 40.608 | 1 | 103 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 2.62E-36 | 3 | 103 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.1E-14 | 9 | 77 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009611 | Biological Process | response to wounding | ||||
| GO:0009788 | Biological Process | negative regulation of abscisic acid-activated signaling pathway | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0020039 | anatomy | leaf lamina | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 248 aa Download sequence Send to blast |
MALYGEKEWY FFSPRDRKYP NGSRPNRAAG SGYWKATGAD KPVGSPKPVA IKKALVFYAG 60 KAPKGEKTNW IMHEYRLADV DRSARKKNSL RLDDWVLCRI YNKKGGLEKP PAAAVAAAGM 120 VSSGGGVQRK PMVGVNAAVS SPPEQKPVVA GPAFPDLAAY YDRPSDSMPR LHADSSCSEQ 180 VLSPEFACEV QSQPKISEWE RTFATVGPIN PAASILDPAG SGGLGGLGGG GSDPLLQDIL 240 MYWGKPF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 1e-48 | 2 | 109 | 66 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 1e-48 | 2 | 109 | 66 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 1e-48 | 2 | 109 | 66 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 1e-48 | 2 | 109 | 66 | 171 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 2e-48 | 2 | 109 | 69 | 174 | NAC domain-containing protein 19 |
| 3swm_B | 2e-48 | 2 | 109 | 69 | 174 | NAC domain-containing protein 19 |
| 3swm_C | 2e-48 | 2 | 109 | 69 | 174 | NAC domain-containing protein 19 |
| 3swm_D | 2e-48 | 2 | 109 | 69 | 174 | NAC domain-containing protein 19 |
| 3swp_A | 2e-48 | 2 | 109 | 69 | 174 | NAC domain-containing protein 19 |
| 3swp_B | 2e-48 | 2 | 109 | 69 | 174 | NAC domain-containing protein 19 |
| 3swp_C | 2e-48 | 2 | 109 | 69 | 174 | NAC domain-containing protein 19 |
| 3swp_D | 2e-48 | 2 | 109 | 69 | 174 | NAC domain-containing protein 19 |
| 4dul_A | 1e-48 | 2 | 109 | 66 | 171 | NAC domain-containing protein 19 |
| 4dul_B | 1e-48 | 2 | 109 | 66 | 171 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Os.51926 | 4e-79 | callus| flower| leaf| panicle| root| stem | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 115484514 | 4e-79 | ||||
| Expression Atlas | Q7F2L3 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10660065}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses (PubMed:20632034). Transcription activator involved in response to abiotic and biotic stresses. Involved in drought and salt stress responses, and defense response to the rice blast fungus (PubMed:17587305). Transcription activator involved tolerance to cold and salt stresses (PubMed:18273684). Transcription activator involved in tolerance to drought stress. Targets directly and activates genes involved in membrane modification, nicotianamine (NA) biosynthesis, glutathione relocation, accumulation of phosphoadenosine phosphosulfate and glycosylation in roots (PubMed:27892643). Controls root growth at early vegetative stage through chromatin modification and histone lysine deacytaltion by HDAC1 (PubMed:19453457). {ECO:0000269|PubMed:17587305, ECO:0000269|PubMed:18273684, ECO:0000269|PubMed:19453457, ECO:0000269|PubMed:20632034, ECO:0000269|PubMed:27892643}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00121 | DAP | Transfer from AT1G01720 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | LOC_Os01g66120.3 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by drought stress, salt stress, cold stress and abscisic acid (ABA) (PubMed:20632034, PubMed:27892643). Induced by methyl jasmonate (PubMed:20632034, PubMed:11332734). Induced by infection with the rice blast fungus Magnaporthe oryzae (PubMed:11332734). {ECO:0000269|PubMed:11332734, ECO:0000269|PubMed:20632034, ECO:0000269|PubMed:27892643}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| RiceGE | Os01g66120 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB028185 | 0.0 | AB028185.1 Oryza sativa mRNA for OsNAC6 protein, complete cds. | |||
| GenBank | AK068392 | 0.0 | AK068392.1 Oryza sativa Japonica Group cDNA clone:J013149P14, full insert sequence. | |||
| GenBank | EU846993 | 0.0 | EU846993.1 Oryza sativa Japonica Group clone KCS089G05 NAC6 protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015620920.1 | 1e-179 | NAC domain-containing protein 48 | ||||
| Swissprot | Q7F2L3 | 1e-180 | NAC48_ORYSJ; NAC domain-containing protein 48 | ||||
| TrEMBL | A0A0E0N5X5 | 1e-178 | A0A0E0N5X5_ORYRU; Uncharacterized protein | ||||
| STRING | ORUFI01G42940.1 | 1e-178 | (Oryza rufipogon) | ||||
| STRING | OS01T0884300-01 | 1e-178 | (Oryza sativa) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G01720.1 | 2e-84 | NAC family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | LOC_Os01g66120.3 |
| Entrez Gene | 4325006 |




