![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | LOC_Os03g04900.1 | ||||||||
| Common Name | LOC4331584, Os03g0142600, OsJ_09361, OSNPB_030142600 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 248aa MW: 28768.4 Da PI: 7.0863 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 56.2 | 8.1e-18 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+ Ed ll ++v+q+G g+W+++a+ g++R++k+c++rw +yl
LOC_Os03g04900.1 15 KGPWTALEDRLLTEYVQQHGEGSWNSVAKLTGLRRSGKSCRLRWVNYL 62
79********************************************97 PP
| |||||||
| 2 | Myb_DNA-binding | 53.1 | 7.4e-17 | 68 | 112 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
rg+ T++E+ +++++++lG++ W++Iar+++ gRt++++k++w+++
LOC_Os03g04900.1 68 RGKITPDEETVILQLHAMLGNR-WSAIARCLP-GRTDNEIKNYWRTH 112
8999******************.*********.************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 14.842 | 10 | 62 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 1.04E-30 | 12 | 109 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 5.8E-15 | 14 | 64 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 9.6E-17 | 15 | 62 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.9E-23 | 16 | 69 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 2.24E-10 | 17 | 62 | No hit | No description |
| PROSITE profile | PS51294 | 23.403 | 63 | 117 | IPR017930 | Myb domain |
| SMART | SM00717 | 9.9E-16 | 67 | 115 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 9.2E-15 | 68 | 112 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 3.6E-24 | 70 | 115 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 2.41E-10 | 72 | 113 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0020048 | anatomy | microspore | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0007130 | developmental stage | sporophyte reproductive stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 248 aa Download sequence Send to blast |
MDEIRSLMLQ QGWRKGPWTA LEDRLLTEYV QQHGEGSWNS VAKLTGLRRS GKSCRLRWVN 60 YLRPDLKRGK ITPDEETVIL QLHAMLGNRW SAIARCLPGR TDNEIKNYWR THFKKARPSR 120 RARAQLLHQY QLQQQQQHRQ YLHSLNLLQQ QQQQLQQQQQ QQQQQMMLLQ EQEQQSPQEE 180 AADDSMVMMM MNDLQSKERC CTAVSVVPDD CVLPADDDAI WDSLWRLVDG DGSCGEGSSG 240 GEYWATS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 3e-27 | 15 | 115 | 27 | 126 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 115450664 | 0.0 | ||||
| Expression Atlas | Q10RX9 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Present in a small patch of cells on the innermost side of the hypocotyl hook of the germinating seedling, in the subapical pith cells of plants growing vegetatively, in a similar zone of expanding cells both in developing inflorescence stems, and below mature flowers and elongating siliques (PubMed:11743113). Accumulates in the pollen tube nucleus during pollen tube growth through the pistil (PubMed:23791732). {ECO:0000269|PubMed:11743113, ECO:0000269|PubMed:23791732}. | |||||
| Uniprot | TISSUE SPECIFICITY: Present mostly in flowers, siliques and floral shoot tips (PubMed:11743113, PubMed:25268707). Expression is restricted to the subapical pith cells of both vegetative and flowering plants and to the hypocotyl hook (PubMed:11743113). Expressed in pollen grains and pollen tube (PubMed:23791732, PubMed:24278028). Mostly expressed in mature pollen grains, and, to a lower extent, in inflorescences and siliques (PubMed:24278028). {ECO:0000269|PubMed:11743113, ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028, ECO:0000269|PubMed:25268707}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator (PubMed:24278028, PubMed:25268707). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter (e.g. alpha-amylase) to promote their expression (PubMed:11743113). Positive regulator of abscisic acid (ABA) responses leading to growth arrest during seed germination (PubMed:17217461). Promotes the expression of aleurone-related genes (e.g. CP1, CP, GASA1, BXL1 and BXL2) in seeds. Together with MYB33 and MYB65, promotes the programmed cell death (PCD) leading to vacuolation of protein storage vacuoles (PSVs) in the aleurone layers during seed germination (PubMed:20699403). Maybe involved in the regulation of leaves lamina morphogenesis (PubMed:25268707). Involved in pollen grain development (PubMed:22101548). Together with MYB97 and MYB120, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000269|PubMed:11743113, ECO:0000269|PubMed:17217461, ECO:0000269|PubMed:20699403, ECO:0000269|PubMed:22101548, ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028, ECO:0000269|PubMed:25268707}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | LOC_Os03g04900.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed in germinating seeds by microRNA159 (miR159)-mediated cleavage in an abscisic acid (ABA) and ABI3-dependent manner, probably to desensitize hormone signaling during seedling stress responses (PubMed:15226253, PubMed:17217461). Induced by increased upon gibberellic acid (GA) treatment (PubMed:20699403). {ECO:0000269|PubMed:15226253, ECO:0000269|PubMed:17217461, ECO:0000269|PubMed:20699403}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| RiceGE | Os03g04900 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC122149 | 0.0 | AC122149.2 Oryza sativa Japonica Group chromosome 3 clone OSJNBa0083D24, complete sequence. | |||
| GenBank | AC137697 | 0.0 | AC137697.2 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBb0081A17, from chromosome 3, complete sequence. | |||
| GenBank | AP014959 | 0.0 | AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015630196.1 | 0.0 | transcription factor WER | ||||
| Swissprot | O80883 | 3e-48 | MB101_ARATH; Transcription factor MYB101 | ||||
| TrEMBL | A0A0E0NPI0 | 1e-180 | A0A0E0NPI0_ORYRU; Uncharacterized protein | ||||
| TrEMBL | Q10RX9 | 1e-180 | Q10RX9_ORYSJ; Myb-like DNA-binding domain containing protein | ||||
| STRING | ORUFI03G03040.1 | 0.0 | (Oryza rufipogon) | ||||
| STRING | OS03T0142600-00 | 0.0 | (Oryza sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP13228 | 24 | 33 | Representative plant | OGRP5 | 17 | 1784 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G24310.1 | 7e-62 | myb domain protein 305 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | LOC_Os03g04900.1 |
| Entrez Gene | 4331584 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




