![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | LOC_Os03g05160.1 | ||||||||
| Common Name | LOC4331600, OJ1172F09.7, Os03g0145200, OSNPB_030145200 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 220aa MW: 23369.2 Da PI: 9.02 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 59.9 | 3.2e-19 | 124 | 157 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
C++C + +Tp+WR gpdg++tLCnaCG+++++ +
LOC_Os03g05160.1 124 CTHCAVDETPQWRLGPDGPRTLCNACGVRFKSGR 157
*******************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50114 | 11.517 | 118 | 154 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 1.1E-15 | 118 | 168 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 3.23E-15 | 120 | 182 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 5.3E-14 | 122 | 155 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 6.41E-16 | 124 | 172 | No hit | No description |
| PROSITE pattern | PS00344 | 0 | 124 | 149 | IPR000679 | Zinc finger, GATA-type |
| Pfam | PF00320 | 1.5E-17 | 124 | 157 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0030154 | Biological Process | cell differentiation | ||||
| GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005667 | Cellular Component | transcription factor complex | ||||
| GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
| GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding | ||||
| GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding | ||||
| GO:0003682 | Molecular Function | chromatin binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0007042 | developmental stage | whole plant fruit formation stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 220 aa Download sequence Send to blast |
MVGDKDAAAL AGELTGDAGA SLNGFFDHTG LESAVVGEGQ GEGEEEEELE WLSNKDAFPS 60 VDTMAAEVES AAPGAPARAA VGPRTKGLRR RRRVTAPWSL APLLSRPRQA AAAAADAGAP 120 RRRCTHCAVD ETPQWRLGPD GPRTLCNACG VRFKSGRLFP EYRPANSPTF SPLLHSNSHR 180 RVMEMRLQSE EDASAASRVN AKARRAERAA ARLAGKDKK* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Os.6408 | 0.0 | callus| flower | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 116012100 | 0.0 | ||||
| Expression Atlas | Q8H036 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in roots. Also expressed in stems, flowers and leaves. {ECO:0000269|PubMed:12139008}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | LOC_Os03g05160.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: In leaves, less expressed in dark than in light. {ECO:0000269|PubMed:12139008}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| RiceGE | Os03g05160 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK242735 | 0.0 | AK242735.1 Oryza sativa Japonica Group cDNA, clone: J090048J08, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015629220.1 | 1e-156 | GATA transcription factor 3 | ||||
| Swissprot | Q8L4M6 | 1e-36 | GATA3_ARATH; GATA transcription factor 3 | ||||
| TrEMBL | A0A0E0GGQ1 | 1e-155 | A0A0E0GGQ1_ORYNI; Uncharacterized protein | ||||
| TrEMBL | A2XCF9 | 1e-155 | A2XCF9_ORYSI; Uncharacterized protein | ||||
| TrEMBL | Q8H036 | 1e-155 | Q8H036_ORYSJ; GATA zinc finger family protein | ||||
| STRING | OS03T0145200-01 | 1e-156 | (Oryza sativa) | ||||
| STRING | ONIVA03G03270.1 | 1e-156 | (Oryza nivara) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1417 | 33 | 108 | Representative plant | OGRP68 | 17 | 287 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G54810.2 | 3e-34 | GATA family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | LOC_Os03g05160.1 |
| Entrez Gene | 4331600 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




