![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | LOC_Os04g43560.1 | ||||||||
| Common Name | LOC4336400, Os04g0515900, OSJNBb0070J16.15, OSJNBb0072M01.11, OSNPB_040515900 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 279aa MW: 30802.3 Da PI: 6.4017 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 164.1 | 5.1e-51 | 10 | 137 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93
lppGfrF P+deelv++yL kkv++++ + ++ evd++ ePw+Lp +k + +ewyfFs rd+kyatg+r+nratk+gyWkatgkd+ev
LOC_Os04g43560.1 10 LPPGFRFYPSDEELVCHYLYKKVSNERASQ-GTLVEVDLHAREPWELPDVAKLTASEWYFFSFRDRKYATGSRTNRATKTGYWKATGKDREVR 101
79*************************888.88***************77777889************************************* PP
NAM 94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
s ++++vg++ktLvfy+grap+g+k+ Wvmhe+rl
LOC_Os04g43560.1 102 SPaTRAVVGMRKTLVFYQGRAPNGVKSGWVMHEFRL 137
*977788***************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 1.26E-60 | 8 | 156 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 58.738 | 10 | 156 | IPR003441 | NAC domain |
| Pfam | PF02365 | 4.3E-28 | 11 | 137 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0009005 | anatomy | root | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 279 aa Download sequence Send to blast |
MGLREIESTL PPGFRFYPSD EELVCHYLYK KVSNERASQG TLVEVDLHAR EPWELPDVAK 60 LTASEWYFFS FRDRKYATGS RTNRATKTGY WKATGKDREV RSPATRAVVG MRKTLVFYQG 120 RAPNGVKSGW VMHEFRLDSP HSPPKEDWVL CRVFQKSKGD GEQDNPTSAA SPAATFAGSS 180 QAAVPGQAAY SSDDHTGSSM GFAPRQNEIL DSSSHQLLNL AMLQCNSVLD HFPQEVNSSP 240 MMGLAGSIGI GDEYGFFYDT GFEETASLGG MRFPQGWS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 2e-50 | 1 | 156 | 4 | 165 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 2e-50 | 1 | 156 | 4 | 165 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 2e-50 | 1 | 156 | 4 | 165 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 2e-50 | 1 | 156 | 4 | 165 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 2e-50 | 1 | 156 | 7 | 168 | NAC domain-containing protein 19 |
| 3swm_B | 2e-50 | 1 | 156 | 7 | 168 | NAC domain-containing protein 19 |
| 3swm_C | 2e-50 | 1 | 156 | 7 | 168 | NAC domain-containing protein 19 |
| 3swm_D | 2e-50 | 1 | 156 | 7 | 168 | NAC domain-containing protein 19 |
| 3swp_A | 2e-50 | 1 | 156 | 7 | 168 | NAC domain-containing protein 19 |
| 3swp_B | 2e-50 | 1 | 156 | 7 | 168 | NAC domain-containing protein 19 |
| 3swp_C | 2e-50 | 1 | 156 | 7 | 168 | NAC domain-containing protein 19 |
| 3swp_D | 2e-50 | 1 | 156 | 7 | 168 | NAC domain-containing protein 19 |
| 4dul_A | 2e-50 | 1 | 156 | 4 | 165 | NAC domain-containing protein 19 |
| 4dul_B | 2e-50 | 1 | 156 | 4 | 165 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Os.36651 | 0.0 | leaf| stem | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | Q7X7J4 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: First observed in young embryonic SAM. Later confined to the boundaries between cotyledon primordia and the SAM. In mature embryos, localized around first leaves primordia. Only weakly present in vegetative SAM. In inflorescence, observed at the boundaries between floral organ primordia. In callus, expressed during transition to shoot development, with a progressive restriction to specific areas corresponding to future shoot apex. {ECO:0000269|PubMed:11245578, ECO:0000269|PubMed:12492830}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in inflorescence stems, rosette leaves, aerial parts of seedlings, flowers, floral buds and roots. {ECO:0000269|PubMed:11245578}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:11245578, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:12787253, ECO:0000269|PubMed:14617069, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | LOC_Os04g43560.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. Directly induced by ESR2 in response to cytokinins. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16854978, ECO:0000269|PubMed:17056621, ECO:0000269|PubMed:17287247}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| RiceGE | Os04g43560 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK062955 | 0.0 | AK062955.1 Oryza sativa Japonica Group cDNA clone:001-109-C12, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015634235.1 | 0.0 | protein CUP-SHAPED COTYLEDON 1 | ||||
| Swissprot | Q9FRV4 | 8e-63 | NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1 | ||||
| TrEMBL | A0A0D9ZN59 | 0.0 | A0A0D9ZN59_9ORYZ; Uncharacterized protein | ||||
| TrEMBL | A0A0E0GXN1 | 0.0 | A0A0E0GXN1_ORYNI; Uncharacterized protein | ||||
| TrEMBL | A0A0E0PBK5 | 0.0 | A0A0E0PBK5_ORYRU; Uncharacterized protein | ||||
| TrEMBL | A2XVI6 | 0.0 | A2XVI6_ORYSI; Uncharacterized protein | ||||
| TrEMBL | Q7X7J4 | 0.0 | Q7X7J4_ORYSJ; NAC transcription factor | ||||
| STRING | OGLUM04G18750.1 | 0.0 | (Oryza glumipatula) | ||||
| STRING | ORUFI04G20200.1 | 0.0 | (Oryza rufipogon) | ||||
| STRING | OS04T0515900-01 | 0.0 | (Oryza sativa) | ||||
| STRING | ONIVA04G01950.1 | 0.0 | (Oryza nivara) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP697 | 38 | 166 | Representative plant | OGRP17 | 15 | 800 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G28530.1 | 6e-82 | NAC domain containing protein 74 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | LOC_Os04g43560.1 |
| Entrez Gene | 4336400 |




