![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | LOC_Os04g58680.1 | ||||||||
| Common Name | LOC107278593, Os04g0683400, OsHAP5G, OsJ_16673, OSJNBa0032F06.24, OSNPB_040683400 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 126aa MW: 13221 Da PI: 9.1825 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 83.8 | 1.9e-26 | 54 | 116 | 37 | 99 |
NF-YC 37 kmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99
+mis eaPv++skacelfi elt r+w + e krrt++k d+aaav++td fdflvd+v d
LOC_Os04g58680.1 54 RMISGEAPVVFSKACELFIAELTRRAWAATLEGKRRTVHKEDVAAAVQNTDLFDFLVDVVTAD 116
8**********************************************************9876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 2.1E-24 | 18 | 109 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 3.5E-31 | 19 | 101 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.6E-12 | 52 | 100 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 126 aa Download sequence Send to blast |
MRQARPYSAM FAGGVSARTG PHALPLARIK KIMKRSAGDS SVVDGGGGGG GGARMISGEA 60 PVVFSKACEL FIAELTRRAW AATLEGKRRT VHKEDVAAAV QNTDLFDFLV DVVTADLGDD 120 HTDYK* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_B | 6e-31 | 22 | 113 | 16 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
| Search in ModeBase | ||||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | Q7XPV7 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072}. | |||||
| Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:9662544}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the regulation of flowering time under long day (LD) conditions. Functions as repressor of flowering, independently of HD1 and GHD7. Controls flowering time by negatively regulating the expression of EHD1 and HD3A (PubMed:26542958). Component of the NF-Y/HAP transcription factor complex (By similarity). {ECO:0000250, ECO:0000269|PubMed:26542958}. | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | LOC_Os04g58680.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian-regulation under long day (LD) conditions. Expression increases in the middle of daytime, peaks around the end of the light period and gradually decreases during the dark period and beginning of daylight. {ECO:0000269|PubMed:26542958}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| RiceGE | Os04g58680 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB288047 | 0.0 | AB288047.1 Oryza sativa Japonica Group OsHAP5G gene for HAP5 subunit of HAP complex, complete cds. | |||
| GenBank | AL606641 | 0.0 | AL606641.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0032F06, complete sequence. | |||
| GenBank | AP014960 | 0.0 | AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015635297.1 | 7e-87 | nuclear transcription factor Y subunit C-2 | ||||
| Swissprot | Q655V5 | 2e-29 | NFYC4_ORYSJ; Nuclear transcription factor Y subunit C-4 | ||||
| Swissprot | Q8LCG7 | 4e-30 | NFYC2_ARATH; Nuclear transcription factor Y subunit C-2 | ||||
| Swissprot | Q9ZVL3 | 8e-30 | NFYC3_ARATH; Nuclear transcription factor Y subunit C-3 | ||||
| TrEMBL | Q7XPV7 | 2e-85 | Q7XPV7_ORYSJ; HAP5 subunit of HAP complex | ||||
| STRING | OS04T0683400-00 | 3e-86 | (Oryza sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP11658 | 33 | 39 | Representative plant | OGRP315 | 17 | 117 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G56170.2 | 6e-31 | nuclear factor Y, subunit C2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | LOC_Os04g58680.1 |
| Entrez Gene | 107278593 |




