![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | LOC_Os05g09020.2 | ||||||||
| Common Name | LOC4337998, Os05g0183100, P0683B12.4 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 128aa MW: 14169.8 Da PI: 9.8091 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 96.9 | 1.4e-30 | 28 | 86 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDg++WrKYG+K vk+s++pr+YYrC+++gC+vkk+ver++ed ++v++tY g Hnh
LOC_Os05g09020.2 28 LDDGFKWRKYGKKAVKNSPNPRNYYRCSTEGCNVKKRVERDREDHRYVITTYDGVHNHA 86
59********************************************************6 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 6.3E-33 | 16 | 88 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 6.02E-28 | 20 | 88 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 31.422 | 23 | 88 | IPR003657 | WRKY domain |
| SMART | SM00774 | 2.5E-34 | 28 | 87 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.1E-23 | 29 | 85 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
| GO:0050832 | Biological Process | defense response to fungus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0009038 | anatomy | palea | ||||
| PO:0001048 | developmental stage | palea development stage | ||||
| PO:0007130 | developmental stage | sporophyte reproductive stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 128 aa Download sequence Send to blast |
MRYESEEKMR ARVNGRIGFR TRSEVEILDD GFKWRKYGKK AVKNSPNPRN YYRCSTEGCN 60 VKKRVERDRE DHRYVITTYD GVHNHASPAA AAAALQYAAA AGDYYSPPLS SAGSPPAAYS 120 AGGSLLF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 2e-27 | 14 | 89 | 3 | 78 | Probable WRKY transcription factor 4 |
| 2lex_A | 2e-27 | 14 | 89 | 3 | 78 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Os.19621 | 1e-133 | leaf| panicle| root| stem | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 116632997 | 1e-133 | ||||
| Expression Atlas | Q65WY5 | - | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00531 | DAP | Transfer from AT5G26170 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | LOC_Os05g09020.2 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| RiceGE | Os05g09020 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CT832802 | 0.0 | CT832802.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN033C24, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015638018.1 | 4e-90 | probable WRKY transcription factor 50 | ||||
| Swissprot | Q8VWQ5 | 5e-39 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
| TrEMBL | A0A0E0PIC8 | 1e-88 | A0A0E0PIC8_ORYRU; Uncharacterized protein | ||||
| TrEMBL | Q65WY5 | 1e-88 | Q65WY5_ORYSJ; Os05g0183100 protein | ||||
| TrEMBL | Q6IEL4 | 1e-88 | Q6IEL4_ORYSI; WRKY transcription factor 67 | ||||
| STRING | ORUFI05G05890.1 | 2e-89 | (Oryza rufipogon) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26170.1 | 9e-40 | WRKY DNA-binding protein 50 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | LOC_Os05g09020.2 |
| Entrez Gene | 4337998 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




