| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | SRF-TF | 90.5 | 8.2e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien +nrqvt+skRr+gi+KKA EL vLCda+va+i+fsstgk +e++s
LOC_Os06g49840.1 9 KRIENATNRQVTYSKRRTGIMKKARELTVLCDAQVAIIMFSSTGKYHEFCS 59
79***********************************************96 PP
|
| 2 | K-box | 86.5 | 5.3e-29 | 71 | 168 | 1 | 98 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93
yq++ g+sl+ +++e++q+ l+ Lk+ ++nL++e+R+++GedL+ L++ eL+ Leq+++ +lk++R +K++++++q+e+ +kk k e+ ++
LOC_Os06g49840.1 71 YQQAIGTSLWIEQYENMQRTLSHLKDINRNLRTEIRQRMGEDLDGLEFDELRGLEQNVDAALKEVRHRKYHVITTQTETYKKKVKHSYEAYET 163
67888999************************************************************************************* PP
K-box 94 Lrkkl 98
L+++l
LOC_Os06g49840.1 164 LQQEL 168
*9986 PP
|
| Publications
? help Back to Top |
- Shinozuka Y, et al.
Isolation and characterization of rice MADS box gene homologues and their RFLP mapping. DNA Res., 1999. 6(2): p. 123-9 [PMID:10382970] - Moon YH,Jung JY,Kang HG,An G
Identification of a rice APETALA3 homologue by yeast two-hybrid screening. Plant Mol. Biol., 1999. 40(1): p. 167-77 [PMID:10394955] - Nagasawa N, et al.
SUPERWOMAN1 and DROOPING LEAF genes control floral organ identity in rice. Development, 2003. 130(4): p. 705-18 [PMID:12506001] - Cooper B, et al.
A network of rice genes associated with stress response and seed development. Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50 [PMID:12684538] - Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] - Lee S, et al.
Alteration of floral organ identity in rice through ectopic expression of OsMADS16. Planta, 2003. 217(6): p. 904-11 [PMID:12905025] - Xiao H, et al.
Functional analysis of the rice AP3 homologue OsMADS16 by RNA interference. Plant Mol. Biol., 2003. 52(5): p. 957-66 [PMID:14558657] - Chen ZX, et al.
Morphogenesis and molecular basis on naked seed rice, a novel homeotic mutation of OsMADS1 regulating transcript level of AP3 homologue in rice. Planta, 2006. 223(5): p. 882-90 [PMID:16254725] - Zhang Q, et al.
Morphological, anatomical and genetic analysis for a rice mutant with abnormal hull. J Genet Genomics, 2007. 34(6): p. 519-26 [PMID:17601611] - Yoshida H, et al.
superwoman1-cleistogamy, a hopeful allele for gene containment in GM rice. Plant Biotechnol. J., 2007. 5(6): p. 835-46 [PMID:17764519] - Yao SG,Ohmori S,Kimizu M,Yoshida H
Unequal genetic redundancy of rice PISTILLATA orthologs, OsMADS2 and OsMADS4, in lodicule and stamen development. Plant Cell Physiol., 2008. 49(5): p. 853-7 [PMID:18378529] - Xiao H, et al.
STAMENLESS 1, encoding a single C2H2 zinc finger protein, regulates floral organ identity in rice. Plant J., 2009. 59(5): p. 789-801 [PMID:19453444] - Seok HY, et al.
Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] - Li H, et al.
Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] - Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T
Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58. Plant Sci., 2012. 183: p. 183-9 [PMID:22195592] - Ohmori S,Tabuchi H,Yatou O,Yoshida H
Agronomic traits and gene containment capability of cleistogamous rice lines with the superwoman1-cleistogamy mutation. Breed. Sci., 2012. 62(2): p. 124-32 [PMID:23136523] - Yun D, et al.
OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice. Mol Plant, 2013. 6(3): p. 743-56 [PMID:23300256] - Lombardo F, et al.
The superwoman1-cleistogamy2 mutant is a novel resource for gene containment in rice. Plant Biotechnol. J., 2017. 15(1): p. 97-106 [PMID:27336225]
|