| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | SRF-TF | 100.3 | 7.4e-32 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtfskRrng+lKKA+E+SvLCdaeva i+fs++gklyey++
LOC_Os07g01820.6 9 KRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAAIVFSPKGKLYEYAT 59
79***********************************************86 PP
|
| 2 | K-box | 17.4 | 1.8e-07 | 77 | 109 | 3 | 35 |
K-box 3 kssgksleeakaeslqqelakLkkeienLqreq 35
++ s+e++ + ++++e++kLk++ie++q+ +
LOC_Os07g01820.6 77 EKALISAESESEGNWCHEYRKLKAKIETIQKCH 109
5556677888899*****************987 PP
|
| Publications
? help Back to Top |
- Shinozuka Y, et al.
Isolation and characterization of rice MADS box gene homologues and their RFLP mapping.
DNA Res., 1999. 6(2): p. 123-9
[PMID:10382970] - Moon YH, et al.
Determination of the motif responsible for interaction between the rice APETALA1/AGAMOUS-LIKE9 family proteins using a yeast two-hybrid system.
Plant Physiol., 1999. 120(4): p. 1193-204
[PMID:10444103] - Kyozuka J,Kobayashi T,Morita M,Shimamoto K
Spatially and temporally regulated expression of rice MADS box genes with similarity to Arabidopsis class A, B and C genes.
Plant Cell Physiol., 2000. 41(6): p. 710-8
[PMID:10945340] - Lim J,Moon YH,An G,Jang SK
Two rice MADS domain proteins interact with OsMADS1.
Plant Mol. Biol., 2000. 44(4): p. 513-27
[PMID:11197326] - Cooper B, et al.
A network of rice genes associated with stress response and seed development.
Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
[PMID:12684538] - Cai Q, et al.
[PAEs in composts of municipal sludge and rice straw].
Ying Yong Sheng Tai Xue Bao, 2003. 14(11): p. 1993-6
[PMID:14997664] - Wang K, et al.
DEP and AFO regulate reproductive habit in rice.
PLoS Genet., 2010. 6(1): p. e1000818
[PMID:20107517] - Kobayashi K, et al.
Inflorescence meristem identity in rice is specified by overlapping functions of three AP1/FUL-like MADS box genes and PAP2, a SEPALLATA MADS box gene.
Plant Cell, 2012. 24(5): p. 1848-59
[PMID:22570445] - Ramanujam R,Yishi X,Liu H,Naqvi NI
Structure-function analysis of Rgs1 in Magnaporthe oryzae: role of DEP domains in subcellular targeting.
PLoS ONE, 2012. 7(7): p. e41084
[PMID:22927898] - Ang TN,Ngoh GC,Chua AS,Lee MG
Elucidation of the effect of ionic liquid pretreatment on rice husk via structural analyses.
Biotechnol Biofuels, 2012. 5(1): p. 67
[PMID:22958710] - Ren D, et al.
MULTI-FLORET SPIKELET1, which encodes an AP2/ERF protein, determines spikelet meristem fate and sterile lemma identity in rice.
Plant Physiol., 2013. 162(2): p. 872-84
[PMID:23629832] - Zhang G,Huang K,Jiang X,Huang D,Yang Y
Acetylation of rice straw for thermoplastic applications.
Carbohydr Polym, 2013. 96(1): p. 218-26
[PMID:23688473] - Wei X, et al.
Fine mapping of BH1, a gene controlling lemma and palea development in rice.
Plant Cell Rep., 2013. 32(9): p. 1455-63
[PMID:23689259] - Hu S, et al.
A point mutation in the zinc finger motif of RID1/EHD2/OsID1 protein leads to outstanding yield-related traits in japonica rice variety Wuyunjing 7.
Rice (N Y), 2013. 6(1): p. 24
[PMID:24280027] - Ji Y, et al.
A comprehensive assessment of human exposure to phthalates from environmental media and food in Tianjin, China.
J. Hazard. Mater., 2014. 279: p. 133-40
[PMID:25051237] - Huang Y, et al.
Phthalates in Commercial Chinese Rice Wines: Concentrations and the Cumulative Risk Assessment to Adult Males in Shanghai.
Biomed. Environ. Sci., 2014. 27(10): p. 819-23
[PMID:25341819] - Tamaki S, et al.
FT-like proteins induce transposon silencing in the shoot apex during floral induction in rice.
Proc. Natl. Acad. Sci. U.S.A., 2015. 112(8): p. E901-10
[PMID:25675495] - Wu F, et al.
The ABCs of flower development: mutational analysis of AP1/FUL-like genes in rice provides evidence for a homeotic (A)-function in grasses.
Plant J., 2017. 89(2): p. 310-324
[PMID:27689766]
|
