PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g25150.1
Organism
Oryza sativa subsp. japonica
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 69aa    MW: 7681.86 Da    PI: 9.9016
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g25150.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.12e-082381248
                      HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding 12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      l+ +++++G g+W++++   g  R+ k+c +rw +yl
  LOC_Os07g25150.1  2 LASYIQEHGAGNWRAVPTNTGVMRCSKSCPLRWTNYL 38
                      7899*******************************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001673.31E-4138No hitNo description
SuperFamilySSF466891.79E-15165IPR009057Homeodomain-like
PROSITE profilePS5129414.007142IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-12241IPR009057Homeodomain-like
PfamPF002491.2E-7238IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-74265IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 69 aa     Download sequence    Send to blast
MLASYIQEHG AGNWRAVPTN TGVMRCSKSC PLRWTNYLQP GIKRGNFTEQ EEKLIVHLQA  60
LLGNRSLP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.789011e-114callus| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329734741e-114
Expression AtlasB7E8L8-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in 2-week-old seedlings, in the early stages of development. {ECO:0000269|PubMed:10571865}.
UniprotTISSUE SPECIFICITY: Expressed in vascular tissues of leaves, hypocotyl and roots. {ECO:0000269|PubMed:24587042}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to the DNA sequence 5'-AACAAAC-3' (PubMed:19170933). Acts as a positive regulator of hypersensitive cell death (PubMed:10571865, PubMed:12119395). Acts as a positive regulator of salicylic acid synthesis (PubMed:16730712). Regulates very-long-chain fatty acid biosynthesis (PubMed:18326828). Acts cooperatively with BZR2 to promote expression of a subset of brassinosteroids target genes (PubMed:19170933). Transcriptional activity and hypersensitive response control negatively regulated by PLA2-ALPHA and by the Xanthomonas type III effector XopD (AC G9L9K6) (PubMed:20696912, PubMed:21917550). Involved in the regulation of abscisic acid (ABA) signaling (PubMed:22814374). Increased levels of MYB30 can accelerate flowering both in long and short days through the regulation of FT (PubMed:24587042). {ECO:0000269|PubMed:10571865, ECO:0000269|PubMed:12119395, ECO:0000269|PubMed:16730712, ECO:0000269|PubMed:18326828, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20696912, ECO:0000269|PubMed:21917550, ECO:0000269|PubMed:22814374, ECO:0000269|PubMed:24587042}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g25150.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated during hypersensitive response, but no expression detected during compatible interaction with pathogens (PubMed:10571865). Specifically induced in the inoculated zone 4 hours post pathogen infection (PubMed:20696912). Up-regulated by jasmonic acid and salicylic acid (PubMed:16463103, PubMed:16730712). Transcriptionally regulated by BZR2 (PubMed:19170933). {ECO:0000269|PubMed:10571865, ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16730712, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20696912}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g25150
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0634561e-112AK063456.1 Oryza sativa Japonica Group cDNA clone:001-115-G07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647825.13e-42transcription factor MYB101 isoform X1
RefseqXP_015647826.13e-42transcription factor MYB101 isoform X1
RefseqXP_015647827.13e-42transcription factor MYB101 isoform X1
RefseqXP_015647828.13e-42transcription factor MYB101 isoform X1
RefseqXP_015647829.13e-42transcription factor MYB101 isoform X1
RefseqXP_015647830.13e-42transcription factor MYB101 isoform X1
RefseqXP_015647831.13e-42transcription factor MYB101 isoform X1
RefseqXP_015647832.13e-42transcription factor MYB101 isoform X1
RefseqXP_015647833.13e-42transcription factor MYB101 isoform X1
RefseqXP_015647834.13e-42transcription factor MYB101 isoform X1
RefseqXP_015647835.13e-42transcription factor MYB101 isoform X1
RefseqXP_015647836.13e-42transcription factor MYB101 isoform X1
RefseqXP_015647837.13e-42transcription factor MYB101 isoform X1
RefseqXP_015647838.13e-42transcription factor MYB101 isoform X1
RefseqXP_015647840.13e-42transcription factor MYB101 isoform X1
RefseqXP_025882556.13e-42transcription factor MYB101 isoform X1
SwissprotQ9SCU72e-35MYB30_ARATH; Transcription factor MYB30
TrEMBLB7E8L86e-44B7E8L8_ORYSJ; cDNA clone:001-115-G07, full insert sequence
TrEMBLQ0D6W47e-43Q0D6W4_ORYSJ; Os07g0432800 protein (Fragment)
STRINGOS07T0484700-011e-41(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP4047523
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.17e-38myb domain protein 30
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Kaurilind E,Xu E,Brosché M
    A genetic framework for H2O2 induced cell death in Arabidopsis thaliana.
    BMC Genomics, 2015. 16: p. 837
    [PMID:26493993]
  3. Lee HG,Seo PJ
    The Arabidopsis MIEL1 E3 ligase negatively regulates ABA signalling by promoting protein turnover of MYB96.
    Nat Commun, 2016. 7: p. 12525
    [PMID:27615387]
  4. Serrano I, et al.
    A non canonical subtilase attenuates the transcriptional activation of defence responses in Arabidopsis thaliana.
    Elife, 2017.
    [PMID:27685353]
  5. Liao C,Zheng Y,Guo Y
    MYB30 transcription factor regulates oxidative and heat stress responses through ANNEXIN-mediated cytosolic calcium signaling in Arabidopsis.
    New Phytol., 2017. 216(1): p. 163-177
    [PMID:28726305]
  6. Lee HG,Kim J,Suh MC,Seo PJ
    The MIEL1 E3 Ubiquitin Ligase Negatively Regulates Cuticular Wax Biosynthesis in Arabidopsis Stems.
    Plant Cell Physiol., 2017. 58(7): p. 1249-1259
    [PMID:28838126]
  7. Mabuchi K, et al.
    MYB30 links ROS signaling, root cell elongation, and plant immune responses.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(20): p. E4710-E4719
    [PMID:29712840]
  8. Zheng Y,Chen Z,Ma L,Liao C
    The Ubiquitin E3 Ligase RHA2b Promotes Degradation of MYB30 in Abscisic Acid Signaling.
    Plant Physiol., 2018. 178(1): p. 428-440
    [PMID:30030326]