![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | LOC_Os08g07740.1 | ||||||||
| Common Name | Hd5, LOC4344784, Os08g0174500, OsHAP3H, OSNPB_080174500 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 298aa MW: 29810.7 Da PI: 6.2351 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 175.8 | 4.3e-55 | 57 | 152 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
+eqdrflPianvsrimk+ lPanakisk++ketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfe yv plk yl++yre+e
LOC_Os08g07740.1 57 KEQDRFLPIANVSRIMKRSLPANAKISKESKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFEAYVGPLKSYLNRYREAE 149
89******************************************************************************************* PP
NF-YB 95 gek 97
gek
LOC_Os08g07740.1 150 GEK 152
997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.5E-50 | 54 | 154 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 5.12E-38 | 59 | 161 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 6.2E-26 | 62 | 126 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 5.2E-18 | 90 | 108 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 93 | 109 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 5.2E-18 | 109 | 127 | No hit | No description |
| PRINTS | PR00615 | 5.2E-18 | 128 | 146 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0001004 | developmental stage | anther development stage | ||||
| PO:0007130 | developmental stage | sporophyte reproductive stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 298 aa Download sequence Send to blast |
MKSRKSYGHL LSPVGSPPLD NESGEAAAAA AAGGGGCGSS AGYVVYGGGG GGDSPAKEQD 60 RFLPIANVSR IMKRSLPANA KISKESKETV QECVSEFISF VTGEASDKCQ REKRKTINGD 120 DLLWAMTTLG FEAYVGPLKS YLNRYREAEG EKADVLGGAG GAAAARHGEG GCCGGGGGGA 180 DGVVIDGHYP LAGGLSHSHH GHQQQDGGGD VGLMMGGGDA GVGYNAGAGS TTTAFYAPAA 240 TAASGNKAYC GGDGSRVMEF EGIGGEEESG GGGGGGERGF AGHLHGVQWF RLKRNTN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 2e-44 | 51 | 147 | 1 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 37542674 | 0.0 | ||||
| Expression Atlas | Q0J7P4 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, culms, nodes, leaf blades, leaf sheaths and young panicles. {ECO:0000269|PubMed:20566706}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the regulation of flowering time under long day (LD) conditions. Functions as repressor of flowering, independently of HD1 and GHD7. Controls flowering time by negatively regulating the expression of EHD1 and HD3A (PubMed:20566706, PubMed:21148627). Regulates plant height by promoting cell elongation in the internodes (PubMed:20566706). Component of the NF-Y/HAP transcription factor complex (By similarity). {ECO:0000250, ECO:0000269|PubMed:20566706, ECO:0000269|PubMed:21148627}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | LOC_Os08g07740.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian-regulation under long day (LD) conditions. Expression increases in the middle of daytime, peaks around the end of the light period and gradually decreases during the dark period and beginning of daylight. {ECO:0000269|PubMed:26542958}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| RiceGE | Os08g07740 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB124650 | 0.0 | AB124650.1 Oryza sativa Japonica Group Hd5 gene for Heading date 5, complete cds, cultivar:Nipponbare. | |||
| GenBank | AB124651 | 0.0 | AB124651.1 Oryza sativa Japonica Group Hd5 mRNA for Heading date 5, complete cds, cultivar:Nipponbare. | |||
| GenBank | AB288039 | 0.0 | AB288039.1 Oryza sativa Japonica Group OsHAP3H gene for HAP3 subunit of HAP complex, complete cds. | |||
| GenBank | AB693200 | 0.0 | AB693200.1 Oryza sativa Japonica Group Hd5 gene for heading date 5, complete cds, cultivar: Hoshinoyume. | |||
| GenBank | AB693202 | 0.0 | AB693202.1 Oryza sativa Japonica Group Hd5 gene for heading date 5, complete cds, cultivar: Italica Liborno. | |||
| GenBank | AB693203 | 0.0 | AB693203.1 Oryza sativa Japonica Group Hd5 gene for heading date 5, complete cds, cultivar: Dunghung Shali. | |||
| GenBank | AB693204 | 0.0 | AB693204.1 Oryza sativa Japonica Group Hd5 gene for heading date 5, complete cds, cultivar: Arroz da Terra. | |||
| GenBank | AP005164 | 0.0 | AP005164.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBa0054L03. | |||
| GenBank | AP014964 | 0.0 | AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence. | |||
| GenBank | HM775396 | 0.0 | HM775396.1 Oryza sativa Japonica Group days to heading 8 gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015649101.1 | 0.0 | nuclear transcription factor Y subunit B-11 | ||||
| Swissprot | Q0J7P4 | 0.0 | HD5_ORYSJ; Nuclear transcription factor Y subunit B-11 | ||||
| TrEMBL | A0A0H5BCL0 | 0.0 | A0A0H5BCL0_ORYSJ; Heading date 5 | ||||
| STRING | OS08T0174500-00 | 0.0 | (Oryza sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP201 | 38 | 331 | Representative plant | OGRP168 | 17 | 170 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 8e-59 | nuclear factor Y, subunit B3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | LOC_Os08g07740.1 |
| Entrez Gene | 4344784 |




