![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | LOC_Os08g09690.2 | ||||||||
| Common Name | LOC4344874, NF-Y18, Os08g0196700, OsHAP2A, OsJ_26347, OSNPB_080196700, P0035F08.38, P0412D08.16 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 187aa MW: 20094.7 Da PI: 10.2331 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 101.8 | 6.7e-32 | 82 | 137 | 2 | 58 |
CBFB_NFYA 2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
ep+YVNa+Qy++Il+RRq+Rak+e+e+k +k rkpylheSRh hAl+R+RgsgGrF
LOC_Os08g09690.2 82 EPIYVNARQYHGILRRRQSRAKAESENKA-NKIRKPYLHESRHLHALKRARGSGGRF 137
8****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 3.0E-33 | 79 | 140 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 36.965 | 80 | 140 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 7.9E-27 | 82 | 137 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 8.3E-24 | 83 | 105 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 8.3E-24 | 114 | 137 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0007042 | developmental stage | whole plant fruit formation stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 187 aa Download sequence Send to blast |
MKPDGETQLR PTAAGHPDPG LGTSSAEYVA SLGPATAPVS YPYISTYYGG TYGAYSGQPL 60 VNAALMAMPP HSVPLVTDAV VEPIYVNARQ YHGILRRRQS RAKAESENKA NKIRKPYLHE 120 SRHLHALKRA RGSGGRFLNS KAVEGKQDTK SVDKKDGAVP SEEKRDKKLA NSIIKLENSS 180 PTTQPG* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 4e-20 | 80 | 141 | 1 | 62 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Os.37238 | 0.0 | callus| leaf| stem | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | Q6Z065 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in stems, caulines, and senescent flowers. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | LOC_Os08g09690.2 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| RiceGE | Os08g09690 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB288027 | 0.0 | AB288027.1 Oryza sativa Japonica Group OsHAP2A mRNA for HAP2 subunit of HAP complex, complete cds. | |||
| GenBank | AK059903 | 0.0 | AK059903.1 Oryza sativa Japonica Group cDNA clone:006-208-G09, full insert sequence. | |||
| GenBank | HQ731479 | 0.0 | HQ731479.1 Oryza sativa Japonica Group NF-Y transcription factor 21 (NF-Y18) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015648196.1 | 1e-134 | nuclear transcription factor Y subunit A-4 isoform X1 | ||||
| Swissprot | Q84JP1 | 2e-36 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
| Swissprot | Q8VY64 | 2e-36 | NFYA4_ARATH; Nuclear transcription factor Y subunit A-4 | ||||
| TrEMBL | Q6Z065 | 1e-133 | Q6Z065_ORYSJ; HAP2 subunit of HAP complex | ||||
| STRING | OS08T0196700-01 | 1e-134 | (Oryza sativa) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G34720.1 | 1e-36 | nuclear factor Y, subunit A4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | LOC_Os08g09690.2 |
| Entrez Gene | 4344874 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




