![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | LOC_Os10g25850.1 | ||||||||
| Common Name | LOC4348557, NF-Y21, Os10g0397900, OsHAP2I, OSNPB_100397900 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 167aa MW: 18313.8 Da PI: 10.2119 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 76.9 | 4e-24 | 67 | 123 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
dep+YVNaKQy++I++RRq+R+ + +e+k+ ++ rk++l e+R+k+A+ R+Rg+gGrF
LOC_Os10g25850.1 67 DEPIYVNAKQYHAIIRRRQRRKIVGSEDKV-AAIRKRILVEARQKQAKLRHRGKGGRF 123
79****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 3.0E-17 | 65 | 126 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 21.88 | 66 | 126 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 6.8E-17 | 68 | 123 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 3.2E-13 | 69 | 91 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 3.2E-13 | 100 | 123 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0020048 | anatomy | microspore | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0007130 | developmental stage | sporophyte reproductive stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 167 aa Download sequence Send to blast |
MGFGESTQGN QRKLDGPGKV STELSLVNLE AKNLHPKPEC NQPIEHIPTK GMKCTPLLPL 60 PTEHADDEPI YVNAKQYHAI IRRRQRRKIV GSEDKVAAIR KRILVEARQK QAKLRHRGKG 120 GRFISIEHPL ELSMDDQISK NGGSASPSSS TVSENSSNVN GFTGDL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 4e-13 | 67 | 125 | 2 | 60 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Os.22789 | 0.0 | leaf| panicle| stem | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | Q338K5 | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | LOC_Os10g25850.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| RiceGE | Os10g25850 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU847005 | 0.0 | EU847005.1 Oryza sativa Japonica Group clone KCS241E10 CCAAT-binding transcription factor mRNA, complete cds. | |||
| GenBank | HQ731478 | 0.0 | HQ731478.1 Oryza sativa Japonica Group NF-Y transcription factor 21 (NF-Y21) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015613426.1 | 1e-120 | nuclear transcription factor Y subunit A-3 | ||||
| TrEMBL | A0A0E0QYQ8 | 1e-119 | A0A0E0QYQ8_ORYRU; Uncharacterized protein | ||||
| TrEMBL | Q338K5 | 1e-119 | Q338K5_ORYSJ; CCAAT-binding transcription factor | ||||
| STRING | OS10T0397900-00 | 1e-120 | (Oryza sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP17468 | 10 | 10 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G72830.1 | 7e-18 | nuclear factor Y, subunit A3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | LOC_Os10g25850.1 |
| Entrez Gene | 4348557 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




