![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | LOC_Os10g26460.1 | ||||||||
| Common Name | BHLH173, ILI7, LOC107277392, Os10g0404300 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
| Family | bHLH | ||||||||
| Protein Properties | Length: 92aa MW: 10033.4 Da PI: 9.4376 | ||||||||
| Description | bHLH family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HLH | 18.9 | 2.7e-06 | 20 | 58 | 16 | 54 |
HHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 16 iNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
i + ++L+ llP+a ++ ++ a +L++++ YI+sL
LOC_Os10g26460.1 20 IGDLVSKLQALLPEARLRSNDRVPSARVLQETCSYIRSL 58
5667799*******8899*******************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.280.10 | 1.8E-7 | 3 | 74 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| PROSITE profile | PS50888 | 10.194 | 4 | 58 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| SuperFamily | SSF47459 | 1.02E-8 | 6 | 80 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009416 | Biological Process | response to light stimulus | ||||
| GO:0040008 | Biological Process | regulation of growth | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 92 aa Download sequence Send to blast |
MSRRSRSRAS SAARITDEQI GDLVSKLQAL LPEARLRSND RVPSARVLQE TCSYIRSLHR 60 EVDDLSERLA ELLAAADVST AQAAVIRGLL M* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Os.101149 | 1e-153 | flower | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | Q338G6 | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | LOC_Os10g26460.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| RiceGE | Os10g26460 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CT836589 | 1e-150 | CT836589.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA333Z79, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015614007.1 | 2e-56 | transcription factor ILI7 | ||||
| Swissprot | Q338G6 | 1e-57 | ILI7_ORYSJ; Transcription factor ILI7 | ||||
| TrEMBL | A0A0E0QYU9 | 4e-55 | A0A0E0QYU9_ORYRU; Uncharacterized protein | ||||
| STRING | ORUFI10G09730.1 | 6e-56 | (Oryza rufipogon) | ||||
| STRING | OS10T0404300-00 | 6e-56 | (Oryza sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2675 | 33 | 78 | Representative plant | OGRP1877 | 12 | 40 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G26945.1 | 5e-18 | bHLH family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | LOC_Os10g26460.1 |
| Entrez Gene | 107277392 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




